KEGG   Vibrio anguillarum NB10: VANGNB10_cI1050cHelp
Entry
VANGNB10_cI1050c  CDS       T03657                                 

Definition
(GenBank) pyridoxal-dependent decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
vau  Vibrio anguillarum NB10
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:vau00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VANGNB10_cI1050c
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VANGNB10_cI1050c
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VANGNB10_cI1050c
   00430 Taurine and hypotaurine metabolism
    VANGNB10_cI1050c
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VANGNB10_cI1050c
Enzymes [BR:vau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VANGNB10_cI1050c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1244131..1245774)
Genome map
AA seq 547 aa AA seqDB search
MVSEQKTANVSFESLLRIFTVPEGPDSTLTKIDQELSRNLNLFLREHIVAEEKPLKEIEK
DFSNPQIPESPEFVSEHTQHLLDNLVAHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYQKNDAFYSQWMHSANHSLGAFCSGGTIANITA
LWVARNNALKADGDFQGVEKEGLFKAMRHYGYHGLAILVSDRGHYSLKKAADVLGIGQEG
LVCVKTDHNNRLCPQDLKAKMAHLKSQKIKSFAVVGVAGTTETGNIDPLRDIANICQQEG
CHFHVDAAWGGATLMSNNHRHLLNGIELADSVTIDAHKQLYIPMGAGMVLFKKPDAMHSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYELLIDQSLAKARYFADL
IKEQDDFELISEPELCLLTYRYIPAFVRQALQQALPNQKAELNELLNEITQFVQKKQRET
GRSFVSRTRLNPERWDKLDTIVFRVVLANPLTTHAILHSILDEQRHIATLAPNLMAKIEL
LAQRIIS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacaaaaaactgcaaatgtgagtttcgagagcttgttacggatcttcact
gtgcccgaaggccccgactcaacactgacaaaaatagaccaagagctatcgcgcaatttg
aacctcttcttgcgtgaacatattgtcgctgaagaaaaaccactcaaagagatcgaaaaa
gatttctctaatccgcaaattccagagtcaccggagttcgtttcagaacatactcagcat
ttgttggataatttagtcgctcattcagtgcatacctcggctcctagctttattggtcat
atgacatctgcactgccatatttcttgatgccgttatcaaagatcatgattgcgctgaat
caaaacttagtcaaaattgaaacgtcaaaagcgtttacaccgctagaacggcaggttttg
ggtatgttgcatcgtttgatctatcaaaaaaacgacgctttttacagccaatggatgcat
agcgctaatcattcgctcggtgcattttgctctggcggaacaattgccaatatcacggca
ttgtgggtggctcgtaataatgctttgaaagccgatggtgatttccaaggcgtcgaaaaa
gaggggctgtttaaagccatgcgtcattatggttaccacgggttagccattttagtgtct
gatcgtggccattactctttaaagaaagccgctgacgtattgggtatcggccaagaaggc
ttggtttgtgtaaaaaccgaccacaacaaccgcttatgcccacaagatttgaaagccaaa
atggcacacctaaaaagccagaaaattaaatcttttgcggttgttggcgtcgccggaacg
acagaaacgggcaacattgatcccttaagagatatcgccaatatttgccagcaagaaggt
tgtcattttcacgtagacgccgcttggggcggtgcaacattaatgtcgaataatcaccga
cacttactcaatggtattgagttggctgactccgtcacgattgatgcacataaacagctc
tacatccctatgggtgcaggcatggtactattcaaaaagcctgatgctatgcattcaatt
gagcaccatgcgcagtatattttgcggaaaggttcaaaagatctaggcagccatacgtta
gaaggttctcgttcaggtatggccatgttggtgtacgctagcatgcacattattagtcgc
cctggctacgaattattgattgaccaaagcctagctaaagctcgctatttcgccgatcta
attaaagaacaagacgattttgaactgatttctgaacccgaactgtgtcttttaacctat
cgttatattcctgcttttgttcgccaagcactgcaacaagccttgcctaatcaaaaagca
gaactgaacgagttgctaaatgaaatcacccagtttgtgcagaaaaaacaaagggaaacg
gggcgttcatttgtctctcgaactcgtttaaacccagaacgctgggacaagcttgatacc
attgtatttcgcgtggtactagccaacccgctaacaacacatgctatcttgcactcgatc
ttagatgagcagcgacatattgccacgctagcccctaatttgatggccaaaattgagcta
cttgctcaaagaatcatcagctag

DBGET integrated database retrieval system