KEGG   Vibrio breoganii: A6E01_06395Help
Entry
A6E01_06395       CDS       T04649                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vbr  Vibrio breoganii
Pathway
vbr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vbr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A6E01_06395
Enzymes [BR:vbr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A6E01_06395
Transporters [BR:vbr02000]
 Other Transporters
  Pores ion channels [TC:1]
   A6E01_06395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ANO32850
UniProt: A0A193KC06
LinkDB All DBs
Position
1:1357004..1357600
Genome map
AA seq 198 aa AA seqDB search
MVVYGDLQSGNCLKVKLILSFLGIEHQWIHVNILENETKTPEFLSINPNGKIPAVALDDG
RTLSESNAILGYFAEGTDFLPTDKYQKAKVYEWLFFEQYSHEPYIAVARFIQKYQGMPEN
RIDEFNSLQEGGNKALALMDSQLSQSNFLVGAQPTIADIALYAYTHVANEGGFNLSNYPH
IQRWIANISAIDGYVDMS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggttgtatatggagatctgcagtctgggaactgtttaaaggtgaaattgattctgtca
ttccttggcatagaacatcagtggattcacgtgaatattctagagaacgaaactaaaact
cctgagtttctttctatcaacccaaacgggaaaatacctgctgttgcccttgatgatgga
cgcactttaagcgaatcaaatgctatcttgggctactttgccgaaggcactgatttcctc
ccaacagataaataccaaaaagccaaagtttatgaatggctgttctttgagcagtattca
cacgaaccctatattgcggtggctaggtttattcaaaagtaccagggaatgcctgaaaat
cgaattgacgagtttaattctctacaagaagggggcaacaaagcgctggctctaatggac
agccagttgtctcaatcaaactttctggtaggtgcacagccaacaatcgccgatattgct
ttatatgcttacacccatgttgccaacgaaggtgggtttaatttatcaaactatcctcac
atacagcgctggattgcgaatatttcagcaatagatggctatgtggacatgtcttga

DBGET integrated database retrieval system