KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1499Help
Entry
Vch1786_I1499     CDS       T01650                                 

Definition
pyruvate kinase II
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Class
Metabolism; Overview; Carbon metabolism [PATH:vce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vce01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vce00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vce00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vce00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
1:1632393..1633838
Genome map
AA seq 481 aa AA seqDB search
MSSTLRRTKIVATLGPSTESPEILEAIIRAGANVVRMNFSHGTAEDHKNRAQKVREIAAK
LGRHVALLGDLQGPKIRVSTFKEGKIILNEGEHFILDAELAKGEGTQESVGIDYKKLPQD
VCNDDILLLDDGRVQLQVMRVEGNKIHTKVLVGGPLSNNKGINKKGGGLSADALTEKDKN
DIRLAAEIQVEYLAVSFPRNGEDMKFARRLAQESGLYARMVAKVERAETVSCDENIDDIV
RASDVIMVARGDLGVEIGDPELIAVQKKLISRAKKLNRVVITATQMMESMISNPMPTRAE
VMDVANAVLDGTDAVMLSGETAAGKYPVETVKAMAEVCIGAEKMIESNEQNYRIKSVFRT
EEEAIAMSTIYAANHLEGVKAMVTLTESGRTALMTSRLNSVFPIFAMSANQATLNRCALL
RGVIPFYFDTKQASGLEAAIAALDALKERNLLEEGDLVIITQGDIMGVEGSTNCMRILPV
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaactttgcgtagaacaaaaatcgtcgccaccttaggtccttccacagaaagc
cctgaaattctcgaagccattatccgagccggagccaatgtcgttcggatgaatttttca
cacggcaccgcggaagaccataaaaaccgtgcgcagaaagttcgcgaaattgccgccaaa
ctcggtcgccacgtcgccttattaggtgatttacaaggtccaaaaattcgtgtttctact
ttcaaagaaggcaaaattatccttaatgaaggggaacacttcattcttgatgcggaatta
gccaaaggggaaggtacgcaagaaagcgtggggattgattacaaaaagctaccgcaagat
gtttgtaacgacgatattttgctgcttgatgatggccgtgtgcagttacaagttatgcga
gttgaaggcaataaaatccacaccaaagtcttggtcggcggtcctctctccaacaataaa
gggattaacaaaaaaggcggcggtttgtcggcagatgctttgactgagaaagacaaaaat
gacattcgacttgcggcagaaattcaagttgagtacctcgcggtgtctttccctcgcaat
ggtgaagacatgaaattcgcgcgccgccttgcccaagaatctgggctttatgcgcgtatg
gtcgccaaagttgaacgcgcagaaaccgtctcttgtgatgaaaacattgatgatattgtt
cgtgcctcggatgtcatcatggtcgcacggggtgatctcggggtggaaatcggtgacccc
gaactcatcgccgtacagaaaaagctgatttcacgcgcgaaaaaactcaaccgtgtggtg
attaccgcaacgcaaatgatggaatcgatgatcagtaaccctatgccaacccgcgccgaa
gtcatggatgtggcgaatgcggtgctcgatggcactgacgctgtgatgctgtcgggagaa
acggctgcgggcaaatatccggttgaaaccgtcaaagcgatggctgaagtctgcattggt
gcagaaaagatgattgagtcgaatgagcaaaactatcgcattaaaagtgtgttccgcacg
gaagaagaagcgattgctatgtcgactatctatgcagccaaccacttagaaggcgttaaa
gccatggtcacgctcaccgaatcaggacgcaccgcattaatgacctcaaggctcaattcc
gtattcccgatttttgcgatgtctgccaaccaagcaaccctcaatcgctgcgcgttattg
cgcggggtgatccctttctacttcgataccaaacaagccagcggtctggaagcagccatt
gcagcattagatgccctcaaagagcgaaacctactcgaagaaggggatctcgtgatcatt
acccaaggcgatattatgggagtcgaaggctccaccaactgtatgcgcatcttacctgtc
tattag

DBGET integrated database retrieval system