KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1499Help
Entry
Vch1786_I1499     CDS       T01650                                 

Definition
(RefSeq) pyruvate kinase II
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vch1786_I1499
   01230 Biosynthesis of amino acids
    Vch1786_I1499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vch1786_I1499
   00620 Pyruvate metabolism
    Vch1786_I1499
  Nucleotide metabolism
   00230 Purine metabolism
    Vch1786_I1499
Enzymes [BR:vce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Vch1786_I1499
Exosome [BR:vce04147]
 Exosomal proteins
  Proteins found in most exosomes
   Vch1786_I1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LinkDB All DBs
Position
1:1632393..1633838
Genome map
AA seq 481 aa AA seqDB search
MSSTLRRTKIVATLGPSTESPEILEAIIRAGANVVRMNFSHGTAEDHKNRAQKVREIAAK
LGRHVALLGDLQGPKIRVSTFKEGKIILNEGEHFILDAELAKGEGTQESVGIDYKKLPQD
VCNDDILLLDDGRVQLQVMRVEGNKIHTKVLVGGPLSNNKGINKKGGGLSADALTEKDKN
DIRLAAEIQVEYLAVSFPRNGEDMKFARRLAQESGLYARMVAKVERAETVSCDENIDDIV
RASDVIMVARGDLGVEIGDPELIAVQKKLISRAKKLNRVVITATQMMESMISNPMPTRAE
VMDVANAVLDGTDAVMLSGETAAGKYPVETVKAMAEVCIGAEKMIESNEQNYRIKSVFRT
EEEAIAMSTIYAANHLEGVKAMVTLTESGRTALMTSRLNSVFPIFAMSANQATLNRCALL
RGVIPFYFDTKQASGLEAAIAALDALKERNLLEEGDLVIITQGDIMGVEGSTNCMRILPV
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaactttgcgtagaacaaaaatcgtcgccaccttaggtccttccacagaaagc
cctgaaattctcgaagccattatccgagccggagccaatgtcgttcggatgaatttttca
cacggcaccgcggaagaccataaaaaccgtgcgcagaaagttcgcgaaattgccgccaaa
ctcggtcgccacgtcgccttattaggtgatttacaaggtccaaaaattcgtgtttctact
ttcaaagaaggcaaaattatccttaatgaaggggaacacttcattcttgatgcggaatta
gccaaaggggaaggtacgcaagaaagcgtggggattgattacaaaaagctaccgcaagat
gtttgtaacgacgatattttgctgcttgatgatggccgtgtgcagttacaagttatgcga
gttgaaggcaataaaatccacaccaaagtcttggtcggcggtcctctctccaacaataaa
gggattaacaaaaaaggcggcggtttgtcggcagatgctttgactgagaaagacaaaaat
gacattcgacttgcggcagaaattcaagttgagtacctcgcggtgtctttccctcgcaat
ggtgaagacatgaaattcgcgcgccgccttgcccaagaatctgggctttatgcgcgtatg
gtcgccaaagttgaacgcgcagaaaccgtctcttgtgatgaaaacattgatgatattgtt
cgtgcctcggatgtcatcatggtcgcacggggtgatctcggggtggaaatcggtgacccc
gaactcatcgccgtacagaaaaagctgatttcacgcgcgaaaaaactcaaccgtgtggtg
attaccgcaacgcaaatgatggaatcgatgatcagtaaccctatgccaacccgcgccgaa
gtcatggatgtggcgaatgcggtgctcgatggcactgacgctgtgatgctgtcgggagaa
acggctgcgggcaaatatccggttgaaaccgtcaaagcgatggctgaagtctgcattggt
gcagaaaagatgattgagtcgaatgagcaaaactatcgcattaaaagtgtgttccgcacg
gaagaagaagcgattgctatgtcgactatctatgcagccaaccacttagaaggcgttaaa
gccatggtcacgctcaccgaatcaggacgcaccgcattaatgacctcaaggctcaattcc
gtattcccgatttttgcgatgtctgccaaccaagcaaccctcaatcgctgcgcgttattg
cgcggggtgatccctttctacttcgataccaaacaagccagcggtctggaagcagccatt
gcagcattagatgccctcaaagagcgaaacctactcgaagaaggggatctcgtgatcatt
acccaaggcgatattatgggagtcgaaggctccaccaactgtatgcgcatcttacctgtc
tattag

DBGET integrated database retrieval system