KEGG   Vibrio cholerae O1 biovar El Tor FJ147: IR04_18305Help
Entry
IR04_18305        CDS       T03827                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vcf  Vibrio cholerae O1 biovar El Tor FJ147
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vcf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IR04_18305
  Energy metabolism
   00680 Methane metabolism
    IR04_18305
Enzymes [BR:vcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     IR04_18305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:2903128..2905758
Genome map
AA seq 876 aa AA seqDB search
MNEKYAALKSNVSMLGRLLGQTIQAADGDVILAKVETIRKLSKSARAGNQADRELLIEEI
KNLPNHQLTPVARAFNQFLNLTNIAEQYHTISRHCESHVNELDAIGSLFAKLAQKSVSKF
DTAQAIRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSPKERHKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWHAVPEFLRELDEQVKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHTITREVLLLSRWKAADLYLTDINELVSELSMTKCNEAVR
ALAGEEHEPYRAILKPIRSLLQETIEILDAKLNGQKLAVKAPLQTADQLWEPLYACYQSL
HECGMGVIADGSLLDTLRRIKAFGVHLVRLDVRQESSRHAEVISELTRHLGIGDYNQWSE
QDKIAFLTTELNSKRPLLPRDWQPSPQVKEVLDTCKIIAAQSKDAFGAYVISMARTASDV
LAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIRQLMNIDLYRGFIQNHQMVMIGYSD
SAKDAGVMAAGWAQYRAMEALVKVGEEAGIELTLFHGRGGTIGRGGAPAHAALLSQPPKS
LKGGLRVTEQGEMIRFKLGLPEVAVNSFNMYASAILEANLLPPPEPKNEWRALMDILSEI
SCNAYRKVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPTGGVESLRAIPWIFSWSQ
NRLILPAWLGAGEAIQIAINEGHQALLEEMCREWPFFSTRLGMLEMVYTKCSVSIACHYD
ERLVEPTLRPLGEKLRAQLQQDIKVVLNVENNENLMQSDPWGQESIRLRNIYIEPLNMLQ
AELLYRTRQSELPAPELEEALMVTIAGIAAGMRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaatacgctgcgctcaaaagtaacgtaagcatgttaggacgactactcggc
cagacaattcaagccgccgatggtgacgttattttagcgaaagtggaaaccatccgaaaa
ctttccaaatctgcccgagcgggcaaccaagcagaccgcgagctgctgatcgaagagatc
aaaaatcttcctaaccaccaactgactcccgtggctcgcgcctttaaccaattcctgaac
ctgaccaatattgccgagcagtatcacaccatctcacgccactgtgaaagccacgtgaat
gagttggatgcgattggtagcctgtttgctaaactggcgcagaagtcggtcagtaaattc
gatacggcgcaagccattcgcgatctcaacattgaactggtattgaccgctcacccgact
gagatcactcgtcgcaccatgatcaacaagctagtcaaaatcaacgaatgtctgtccaaa
cttgagctcagcgacctctctccgaaagagcgccataaaaccgagcgccgccttgagcaa
ttaattgcccaaagttggcattcagatgtgattcgtcagcagcgtccaacgccattagat
gaagccaaatgggggttcgcggtcgtagaaaactcactgtggcacgccgttcctgagttt
ttgcgtgagttagatgaacaggtgaaatcttacctaggtgaaggtttaccgattgatgca
cgccctgtgcatttctcatcttggatgggtggagatcgcgatggtaacccctttgtgacc
cacactatcactcgcgaagtgctgttactgtcacgctggaaagcagccgatttgtatctc
accgatatcaatgaactggtcagcgaactttcgatgaccaagtgtaatgaagccgtacgc
gctttagccggcgaagagcacgaaccttatcgcgccatcctcaagccaatacgaagcttg
ctgcaagagacgattgaaattcttgatgcaaaactcaacggccaaaaactggcagtaaaa
gcccctttgcaaaccgcagatcagttgtgggaaccgctctacgcgtgttaccaatcactg
catgagtgtggcatgggcgtaatcgcagatggttccttgctcgataccctgcgccgcatt
aaagcctttggcgtgcatctggttcgcctcgatgttcgtcaagagagctcacgccatgca
gaagtgatctcggaactgacccgtcatctcggcatcggcgattacaatcagtggagcgag
caagataaaatcgcgttcctgaccacagagctgaactcgaaacgcccactgctaccacgc
gattggcaaccgtcgcctcaagtcaaagaggtgttggatacctgtaagatcatcgctgcg
cagtccaaagatgcctttggcgcttatgtcatttcgatggcgcgtaccgcatcggatgtc
ctcgccgtgcacctgctgctgcaagaggcaggatgtccttatcgtatggatgtttgcccg
ctgtttgaaaccttagatgacttgaacaatgcagaatcggtgatccgtcaactgatgaac
atcgatctgtatcgcggctttattcagaaccaccaaatggtgatgattggttattccgat
tccgccaaagatgcgggggtgatggcagcaggctgggcgcaataccgagcgatggaagcg
ctagtgaaagttggcgaagaagcggggatcgaactcactctattccatggtcgcggcggc
acaattggtcgcggcggtgctcctgcacacgcggcactgctttctcagccaccaaagagt
ttgaagggcggtctgcgtgtaaccgaacaaggcgaaatgatccgctttaaactgggtcta
cctgaagtggcggtcaacagctttaacatgtacgccagcgctattttggaagccaactta
ctacccccaccagagcctaaaaatgagtggcgtgcgctgatggatattctgtcggaaatt
tcatgtaatgcttaccgaaaagtcgtgcgtggtgaaccagactttgttccttacttccgt
caagccacaccagaattagaactcggcaagctgccattgggttccagacccgccaaacgt
aatcctactggtggagtcgagagcctgcgagccattccatggatcttctcatggagccag
aatcgtctcattcttcctgcttggctaggtgcgggtgaagcgatccaaattgccattaat
gaaggacaccaagcgctacttgaagagatgtgccgcgaatggccattcttctcaactcgc
cttggcatgctggaaatggtgtacaccaaatgcagtgtaagcatcgcgtgtcattatgat
gagcgacttgttgaaccgactttgcgtccattgggtgaaaaattgcgtgctcaattacag
caagacattaaagttgtgctgaacgttgagaataacgagaacctgatgcaaagcgatcct
tggggacaagagtcgattcgtctgcgtaacatctatattgaaccactcaacatgctgcaa
gcagaactgctgtatcgtacccgtcaatcagaacttcctgctccagaactggaagaagcc
ttgatggtgaccattgcgggaattgcggcgggaatgcgcaatactggttaa

DBGET integrated database retrieval system