KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0362Help
Entry
VC0362            CDS       T00034                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Brite
Translation factors [BR:vch03012]
 Eukaryotic Type
  Elongation factors
   VC0362 (tuf)
 Prokaryotic Type
   VC0362 (tuf)
Mitochondrial biogenesis [BR:vch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VC0362 (tuf)
Exosome [BR:vch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VC0362 (tuf)
  Exosomal proteins of breast cancer cells
   VC0362 (tuf)
  Exosomal proteins of colorectal cancer cells
   VC0362 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:381760..382944
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTVLAKVYGGKARDFASIDNAPEERERG
ITINTSHVEYDTPNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEAQWEAKIVELAEALDTYIPEPERAVDMAFLMPIEDVFSIQGRGTVVTGRIERGILKVG
DEVAIVGIKETVKTTCTGVEMFRKLLDEGRAGENVGALLRGTKREEVERGQVLAKPGSIT
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGSIELPEGVEMVMPGDNVKMV
VDLIAPIAMDEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacgaaaccgcacgtaaacgttggtactatcggccac
gttgaccacggtaaaacaactctaactgcagctatctgtactgtacttgcaaaagtatac
ggcggtaaagctcgtgacttcgcgtcaatcgacaacgcaccagaagagcgtgagcgtggt
attacaatcaatacttctcacgtagagtacgatactccaaaccgtcactacgcacacgta
gactgtccaggacacgcggattatgttaagaacatgatcaccggtgcagcacagatggac
ggcggtatcctagttgtagcggcaactgacggtccaatgccacaaactcgtgagcacatc
ctgctgggtcgccaagtaggtattccttacatcatcgtattcatgaacaagtgtgacatg
gttgacgatgaagagcttctagagctggtagagatggaagttcgtgagctgctgtctgag
tacgatttcccaggtgatgacctgccagtaatccaaggttcagcactaggcgcgctaaac
ggcgaagcacagtgggaagcgaagattgttgagctagcagaagcactggatacatacatt
ccagagccagagcgtgcagtagacatggcattcctgatgccaatcgaagacgtattctca
atccaaggtcgtggtacagtagtaactggccgtatcgagcgcggcatcctgaaagtgggt
gacgaagtagcgatcgttggtatcaaagagacagtaaaaacgacctgtacaggtgtagag
atgttccgtaagctgcttgacgaaggtcgtgcaggtgagaacgtaggtgcactgctacgt
ggtactaagcgtgaagaagtagagcgtggtcaagtactggcgaagccaggttcaatcaca
ccacacactaagttcgaatcagaagtatacgtactgtcaaaagacgaaggtggccgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaacaggc
agcattgagctaccagaaggcgtagaaatggtaatgccaggcgacaacgtgaagatggtt
gtagacctgattgcaccaatcgcgatggacgaaggtctacgcttcgctatccgtgaaggt
ggccgtactgtaggtgctggtgttgtagctaagatcatcgcttaa

DBGET integrated database retrieval system