KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1456Help
Entry
VC1456            CDS       T00034                                 

Definition
(RefSeq) cholera enterotoxin subunit B
  KO
K10929  
cholera enterotoxin subunit B
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Vibrio cholerae infection
Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vch00001]
 Cellular Processes
  Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VC1456
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    VC1456
Bacterial toxins [BR:vch02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    VC1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
I:complement(1566967..1567341)
Genome map
AA seq 124 aa AA seqDB search
MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAI
ITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAI
SMAN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattaaaatttggtgttttttttacagttttactatcttcagcatatgcacat
ggaacacctcaaaatattactgatttgtgtgcagaataccacaacacacaaatatatacg
ctaaatgataagatattttcgtatacagaatctctagctggaaaaagagagatggctatc
attacttttaagaatggtgcaatttttcaagtagaagtaccaggtagtcaacatatagat
tcacaaaaaaaagcgattgaaaggatgaaggataccctgaggattgcatatcttactgaa
gctaaagtcgaaaagttatgtgtatggaataataaaacgcctcatgcgattgccgcaatt
agtatggcaaattaa

DBGET integrated database retrieval system