KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1784Help
Entry
VC1784            CDS       T00034                                 

Definition
(RefSeq) neuraminidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Other glycan degradation
Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    VC1784
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VC1784
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    VC1784
Enzymes [BR:vch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     VC1784
Bacterial toxins [BR:vch02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   VC1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
I:1933231..1935654
Genome map
AA seq 807 aa AA seqDB search
MSIKMTSQRRRASIHKETDSNIKGVDMRFKNVKKTALMLAMFGMATSSNAALFDYNATGD
TEFDSPAKQGWMQDNTNNGSGVLTNADGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGW
RMTTEMKVLSGGMITNYYANGTQRVLPIISLDSSGNLVVEFEGQTGRTVLATGTAATEYH
KFELVFLPGSNPSASFYFDGKLIRDNIQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQ
GDVIFRGPDRIPSIVASSVTPGVVTAFAEKRVGGGDPGALSNTNDIITRTSRDGGITWDT
ELNLTEQINVSDEFDFSDPRPIYDPSSNTVLVSYARWPTDAAQNGDRIKPWMPNGIFYSV
YDVASGNWQAPIDVTDQVKERSFQIAGWGGSELYRRNTSLNSQQDWQSNAKIRIVDGAAN
QIQVADGSRKYVVTLSIDESGGLVANLNGVSAPIILQSEHAKVHSFHDYELQYSALNHTT
TLFVDGQQITTWAGEVSQENNIQFGNADAQIDGRLHVQKIVLTQQGHNLVEFDAFYLAQQ
TPEVEKDLEKLGWTKIKTGNTMSLYGNASVNPGPGHGITLTRQQNISGSQNGRLIYPAIV
LDRFFLNVMSIYSDDGGSNWQTGSTLPIPFRWKSSSILETLEPSEADMVELQNGDLLLTA
RLDFNQIVNGVNYSPRQQFLSKDGGITWSLLEANNANVFSNISTGTVDASITRFEQSDGS
HFLLFTNPQGNPAGTNGRQNLGLWFSFDEGVTWKGPIQLVNGASAYSDIYQLDSENAIVI
VETDNSNMRILRMPITLLKQKLTLSQN
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaatcaagatgacttcacaacgaagaagagcatcgattcacaaggaaacagattct
aatataaagggagtagatatgcgtttcaaaaacgtaaagaaaaccgctttaatgcttgca
atgttcggtatggcgacaagctcaaacgccgcactttttgactataacgcaacgggtgac
actgagtttgacagtccagccaaacagggatggatgcaagacaacacgaataatggcagc
ggcgttttaaccaatgcagatggaatgcccgcttggttggtgcaaggtattggagggaga
gctcaatggacatattctctctctactaatcaacatgcccaagcatcaagtttcggttgg
cgaatgacgacagaaatgaaagtgctcagtggtggaatgatcacaaactactacgccaac
ggcactcagcgtgtcttacccatcatttcattagatagcagtggtaacttagttgttgag
tttgaagggcaaactggacgcaccgttttggcaaccggcacagcagcaacggaatatcat
aaatttgaattggtattccttcctggaagtaacccatccgctagcttttacttcgatggc
aaactcattcgtgacaacatccagccgactgcatcaaaacaaaatatgatcgtatggggg
aatggctcatcaaatacggatggtgtcgccgcttatcgtgatattaagtttgaaattcaa
ggcgacgtcatcttcagaggcccagaccgtataccgtccattgtagcaagtagcgtaaca
ccaggggtggtaaccgcatttgcagagaaacgtgtggggggaggagatcccggtgctctg
agtaataccaatgacataatcactcgtacctcacgagatggcggtataacttgggatacc
gagctcaacctcactgagcaaatcaatgtcagtgatgagtttgatttctccgatcctcgg
cctatctatgatccttcctccaatacggttcttgtctcttatgctcgatggccgaccgat
gccgctcaaaacggagatcgaataaaaccatggatgccaaacggtattttttacagcgtc
tatgatgttgcatcagggaactggcaagcgcctatcgatgttaccgatcaggtgaaagaa
cgcagtttccaaatcgctggttggggtggttcagagctgtatcgccgaaataccagccta
aatagccagcaagactggcaatcaaacgctaagatccgaattgttgatggtgcagcgaac
cagatacaagttgccgatggtagccgaaaatatgttgtcacactgagtattgatgaatca
ggtggtctagtcgctaatctaaacggtgttagtgctccgattatcctgcaatctgaacac
gcaaaggtacactctttccatgactacgaacttcaatattcggcgttaaaccacaccaca
acgttattcgtggatggtcagcaaatcacaacttgggctggcgaagtatcgcaggagaac
aacattcagtttggtaatgcggatgcccaaattgacggcagactgcatgtgcaaaaaatt
gttctcacacagcaaggccataacctcgtggagtttgatgctttctatttagcacagcaa
acccctgaagtagagaaagaccttgaaaagcttggttggacaaaaattaaaacgggcaac
accatgagtttgtatggaaatgccagtgtcaacccaggaccgggtcatggcatcaccctt
actcgacaacaaaatatcagtggcagccaaaacggccgcttgatctacccagcgattgtg
cttgatcgtttcttcttgaacgtcatgtctatttacagtgatgatggcggttcaaactgg
caaaccggttcaacactccctatcccctttcgctggaagagttcgagtatcctagaaact
ctcgaacctagtgaagctgatatggttgaactccaaaacggtgatctactccttactgca
cgccttgattttaaccaaatcgttaatggtgtgaactatagcccacgccagcaatttttg
agtaaagatggtggaatcacgtggagcctacttgaggctaacaacgctaacgtctttagc
aatatcagtactggtaccgttgatgcttctattactcggttcgagcaaagtgacggtagc
catttcttactctttactaacccacaaggaaaccctgcggggacaaatggcaggcaaaat
ctaggcttatggtttagcttcgatgaaggggtgacatggaaaggaccaattcaacttgtt
aatggtgcatcggcatattctgatatttatcaattggattcggaaaatgcgattgtcatt
gttgaaacggataattcaaatatgcgaattcttcgtatgcctatcacattgctaaaacag
aagctgaccttatcgcaaaactaa

DBGET integrated database retrieval system