KEGG   Vibrio cholerae IEC224: O3Y_02260Help
Entry
O3Y_02260         CDS       T01766                                 

Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
vci  Vibrio cholerae IEC224
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:vci01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vci01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vci00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vci00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vci00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
I:complement(514742..516154)
Genome map
AA seq 470 aa AA seqDB search
MKKTKIVCTIGPKTESVEKLTELVNAGMNVMRLNFSHGDYVEHGTRITNFRKVMEVTGKQ
LAILLDTKGPEIRTIKLENGDDVDLVAGQEFTFTTDTKVVGNKERVAVTYSGFAKDLNVG
NRILVDDGLIEMEVLATTDTEVKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKF
GCEQGVDFVAASFIRKGSDVKEIREVLASHGGQNIQIISKIENQEGLDNFDEILELSDGI
MVARGDLGVEIPAEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AIMDGTDAVMLSGETAKGKYPVEAVKIMAQIAERTDPVLKAELGSRLDSPRLRITEAVCK
GAVDTAEKLAAPLIIVATEAGKSARSVRKYFPTANIIAVTTNKKTAAQLVLSKGVTPVVV
DAIDNTDAFYHLGKEIALQSGLGKKGDIVVMVSGALVASGTTNTASVHVL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccaaaatcgtatgtacgattggcccaaaaactgagtctgtagagaaactg
actgagcttgtaaacgctggcatgaatgttatgcgtctcaacttctctcacggtgactac
gttgaacacggcactcgtatcactaacttccgtaaagtgatggaagtgaccggtaaacaa
ctggcgatcctactggatactaaaggtccagagatccgtactatcaagctggaaaacggt
gacgatgtggatctggtcgctggccaagagttcactttcacaactgacacgaaagttgtt
ggtaacaaagagcgcgtagcagtcacttactctggttttgcaaaagacctgaacgtgggc
aaccgtattctggttgacgacggtcttatagagatggaagtactggcgaccactgacact
gaagtgaagtgtaaagttctgaacaacggcgctctgggtgaaaacaaaggtgttaacctg
ccaggcgtttctgtcaatctgccagcgctgtctgaaaaagacaaaaacgacctgaaattt
ggttgtgagcaaggcgttgatttcgttgctgcctctttcatccgtaaaggttctgacgtg
aaagaaatccgtgaagtattagcttctcacggcggtcaaaacattcaaatcatctctaaa
atcgaaaaccaagaaggcttggacaacttcgatgagatccttgagctgtctgacggcatc
atggttgcacgtggcgacctaggtgtagaaatcccagcagaagaagttatcttcgctcaa
aagatgatgatcgagaaatgtaaccgtgcacgtaaagtggttatcacggcgacgcaaatg
ctggattcaatgatcaagaacccacgtccaactcgcgcagaagcgggcgacgttgcgaac
gcgatcatggatggtactgatgctgtaatgctttctggcgaaacagcaaaaggtaagtac
ccagttgaagcggtgaagatcatggcgcaaattgctgagcgtactgaccctgtactgaaa
gcagaactgggttcacgcctagacagcccacgtctacgtatcactgaagccgtatgtaaa
ggtgcagtagacaccgcagagaaactggcagcgccactgatcatcgtagcaactgaagcg
ggtaaatctgctcgttcagttcgtaagtacttcccaacggctaacattattgcagtcacc
accaacaagaaaacagcagctcagttagtgctttctaaaggtgtaacgccagttgtggtt
gacgcgattgacaacactgacgctttctaccacctaggtaaagagattgcgctgcaatct
ggccttggcaagaaaggcgacatcgtagtgatggtttcaggcgcactggttgcttctggc
acaacgaacactgcatcagtacacgtactgtaa

DBGET integrated database retrieval system