KEGG   Vibrio cholerae IEC224: O3Y_14638Help
Entry
O3Y_14638         CDS       T01766                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vci  Vibrio cholerae IEC224
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3Y_14638
Enzymes [BR:vci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     O3Y_14638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:complement(270181..271581)
Genome map
AA seq 466 aa AA seqDB search
MKSSYVVLCATFAAASFTSSVQAEAILHAFNWKYADVTANAAQIAAAGYKKVLISPALKS
SGNEWWARYQPQDLRVIDSPLGNKTDLQTLIKTLQDYGVEVYSDVVFNHMANESWKRSDL
NYPGSEVLASYTNQAYYYQQQKLFGDLSHNLFSQNDFHPEGCITDWGNPGHVQYWRLCGG
AGDRGLPDLDANAWVINQQRAYLQALKQMGIRGFRIDAVKHMSQYHIDQVFTPEIISGMH
VFGEVITSGGQGDGSYDAFLAPYLNNTTHAAYDFPLFASIRAAFSYQGSMSQLHDPQAYG
QALPNARAITFAITHDIPTNDGFRYQILNPQDEQLAYAYLLGKDGGTPLIYSDDLADHED
KDNGRWANVWNQPSMQHMLRFHNAMQGKPMTVMYSDSCLLLFKRGKEGVVGINKCGESKN
VTIDTYQHEFNWYQTYQDTLSDDRFSVSSRYHTLTIPARVARMWML
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatcgtatgttgttctttgtgccacattcgcggcagcaagttttactagcagc
gtacaagcagaagccattttgcatgcttttaactggaaatatgcagatgtcactgcgaat
gcagcacagatcgccgccgcaggttataaaaaagtgctgatctcaccagcattgaaatcc
agcggcaatgaatggtgggctcgttaccaacctcaagatctgcgagtcattgactcacct
cttggcaacaaaaccgacttacaaacactgatcaaaacgctgcaagattacggtgttgaa
gtatattcggatgtggtgtttaaccatatggcaaacgaaagttggaagcgtagtgatctc
aattatccgggcagcgaagtactagccagctacactaaccaagcttattactatcaacaa
cagaaactgttcggtgatttgtcgcacaatctcttctcacaaaatgatttccatcctgaa
ggttgtattactgattggggcaaccccggtcatgttcagtattggaggctatgcggtggc
gcaggtgatcgcggtctaccagacttggatgccaacgcttgggtcatcaatcaacagcga
gcctatttacaagcgcttaagcaaatgggtatcagaggatttcgaattgatgcggttaag
cacatgagtcaataccacattgaccaagtcttcacaccagagattatttcgggcatgcat
gtgtttggcgaagtgatcacaagtgggggtcaaggtgatggcagttatgatgccttccta
gctccttatctgaataacaccacacacgccgcatacgactttcctctatttgcctccatt
cgtgccgcattttcttatcaaggttcgatgagtcaattgcatgatccacaagcctatgga
caagcattaccaaacgcccgcgccatcacgtttgcgattacccatgatattcccactaat
gatggattccgttatcagatcctcaacccgcaagatgagcaactcgcttacgcttatcta
ctcgggaaagatggtggaacaccgctgatttatagtgatgatctggctgatcacgaagat
aaagataatggtcgttgggcgaatgtttggaatcaaccatcaatgcaacatatgctgcgc
ttccataacgcaatgcaaggtaaacctatgacggttatgtatagcgactcatgtttgctg
ctcttcaaacggggtaaggaaggtgtcgtaggtattaataaatgtggtgagtcaaaaaat
gtcaccatagatacttatcagcatgaatttaactggtatcagacctatcaagatacttta
agtgacgaccgttttagcgtgagcagtcgctaccatacgttaactatcccagcacgtgtt
gcgcgcatgtggatgctgtaa

DBGET integrated database retrieval system