KEGG   Vibrio cholerae MJ-1236: VCD_002587Help
Entry
VCD_002587        CDS       T00903                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    VCD_002587
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VCD_002587
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     VCD_002587
Bacterial toxins [BR:vcj02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   VCD_002587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1:complement(1711853..1714198)
Genome map
AA seq 781 aa AA seqDB search
MRFKNVKKTALMLAMFGMATSSNAALFDYNATGDTEFDSPAKQGWMQDNTNNGSGVLTNA
DGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGWRMTTEMKVLSGGMITNYYANGTQRVL
PIISLDSSGNLVVEFEGQTGRTVLATGTAATEYHKFELVFLPGSNPSASFYFDGKLIRDN
IQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQGDVIFRGPDRIPSIVASSVTPGVVTA
FAEKRVGGGDPGALSNTNDIITRTSRDGGITWDTELNLTEQINVSDEFDFSDPRPIYDPS
SNTVLVSYARWPTDAAQNGDRIKPWMPNGIFYSVYDVASGNWQAPIDVTDQVKERSFQIA
GWGGSELYRRNTSLNSQQDWQSNAKIRIVDGAANQIQVADGSRKYVVTLSIDESGGLVAN
LNGVSAPIILQSEHAKVHSFHDYELQYSALNHTTTLFVDGQQITTWAGEVSQENNIQFGN
ADAQIDGRLHVQKIVLTQQGHNLVEFDAFYLAQQTPEVEKDLEKLGWTKIKTGNTMSLYG
NASVNPGPGHGITLTRQQNISGSQNGRLIYPAIVLDRFFLNVMSIYSDDGGSNWQTGSTL
PIPFRWKSSSILETLEPSEADMVELQNGDLLLTARLDFNQIVNGVNYSPRQQFLSKDGGI
TWSLLEANNANVFSNISTGTVDASITRFEQSDGSHFLLFTNPQGNPAGTNGRQNLGLWFS
FDEGVTWKGPIQLVNGASAYSDIYQLDSENAIVIVETDNSNMRILRMPITLLKQKLTLSQ
N
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcaaaaacgtaaagaaaaccgctttaatgcttgcaatgttcggtatggcgaca
agctcaaacgccgcactttttgactataacgcaacgggtgacactgagtttgacagtcca
gccaaacagggatggatgcaagacaacacgaataatggcagcggcgttttaaccaatgca
gatggaatgcccgcttggttggtgcaaggtattggagggagagctcaatggacatattct
ctctctactaatcaacatgcccaagcatcaagtttcggttggcgaatgacgacagaaatg
aaagtgctcagtggtggaatgatcacaaactactacgccaacggcactcagcgtgtctta
cccatcatttcattagatagcagtggtaacttagttgttgagtttgaagggcaaactgga
cgcaccgttttggcaaccggcacagcagcaacggaatatcataaatttgaattggtattc
cttcctggaagtaacccatccgctagcttttacttcgatggcaaactcattcgtgacaac
atccagccgactgcatcaaaacaaaatatgatcgtatgggggaatggctcatcaaatacg
gatggtgtcgccgcttatcgtgatattaagtttgaaattcaaggcgacgtcatcttcaga
ggcccagaccgtataccgtccattgtagcaagtagcgtaacaccaggggtggtaaccgca
tttgcagagaaacgtgtggggggaggagatcccggtgctctgagtaataccaatgacata
atcactcgtacctcacgagatggcggtataacttgggataccgagctcaacctcactgag
caaatcaatgtcagtgatgagtttgatttctccgatcctcggcctatctatgatccttcc
tccaatacggttcttgtctcttatgctcgatggccgaccgatgccgctcaaaacggagat
cgaataaaaccatggatgccaaacggtattttttacagcgtctatgatgttgcatcaggg
aactggcaagcgcctatcgatgttaccgatcaggtgaaagaacgcagtttccaaatcgct
ggttggggtggttcagagctgtatcgccgaaataccagcctaaatagccagcaagactgg
caatcaaacgctaagatccgaattgttgatggtgcagcgaaccagatacaagttgccgat
ggtagccgaaaatatgttgtcacactgagtattgatgaatcaggtggtctagtcgctaat
ctaaacggtgttagtgctccgattatcctgcaatctgaacacgcaaaggtacactctttc
catgactacgaacttcaatattcggcgttaaaccacaccacaacgttattcgtggatggt
cagcaaatcacaacttgggctggcgaagtatcgcaggagaacaacattcagtttggtaat
gcggatgcccaaattgacggcagactgcatgtgcaaaaaattgttctcacacagcaaggc
cataacctcgtggagtttgatgctttctatttagcacagcaaacccctgaagtagagaaa
gaccttgaaaagcttggttggacaaaaattaaaacgggcaacaccatgagtttgtatgga
aatgccagtgtcaacccaggaccgggtcatggcatcacccttactcgacaacaaaatatc
agtggcagccaaaacggccgcttgatctacccagcgattgtgcttgatcgtttcttcttg
aacgtcatgtctatttacagtgatgatggcggttcaaactggcaaaccggttcaacactc
cctatcccctttcgctggaagagttcgagtatcctagaaactctcgaacctagtgaagct
gatatggttgaactccaaaacggtgatctactccttactgcacgccttgattttaaccaa
atcgttaatggtgtgaactatagcccacgccagcaatttttgagtaaagatggtggaatc
acgtggagcctacttgaggctaacaacgctaacgtctttagcaatatcagtactggtacc
gttgatgcttctattactcggttcgagcaaagtgacggtagccatttcttactctttact
aacccacaaggaaaccctgcggggacaaatggcaggcaaaatctaggcttatggtttagc
ttcgatgaaggggtgacatggaaaggaccaattcaacttgttaatggtgcatcggcatat
tctgatatttatcaattggattcggaaaatgcgattgtcattgttgaaacggataattca
aatatgcgaattcttcgtatgcctatcacattgctaaaacagaagctgaccttatcgcaa
aactaa

DBGET integrated database retrieval system