KEGG   Vibrio cholerae M66-2: VCM66_A0531Help
Entry
VCM66_A0531       CDS       T00891                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00473  D-Alanine metabolism
vcm00550  Peptidoglycan biosynthesis
vcm01100  Metabolic pathways
vcm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    VCM66_A0531 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VCM66_A0531 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    VCM66_A0531 (ddlA)
Enzymes [BR:vcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VCM66_A0531 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:vcm01011]
 Precursor biosynthesis
  Amino acid ligase
   VCM66_A0531 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_YheCD Glutaminase ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACP07493
UniProt: C3LVI8
LinkDB All DBs
Position
II:complement(483174..484178)
Genome map
AA seq 334 aa AA seqDB search
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFHVIRVEMKKEGWFSEQGALVYLD
TNSATLNSDKASYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFVKAARQGSSVGCYKVTTEDQI
APAIEAAFGFSEQVLVEQAVKPRELEVSAYEMNGKLYISKPGEVIAPEGTFYSYEEKYSA
NSHARTVLEAENLTEKHKELIQTYAERVFIHMKLRHLSRIDFFLTQEGQIYLNEVNTFPG
MTPISMFPKMLEHNGHRFSEFLVQCVTNTLVNAK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacaacaatcctacttttgtgcggtggcggctcatctgagcacgaaatttct
ctcgtatcagccaactacatccaacaacagcttgaactgactccagagtttcacgtgatt
cgagtcgagatgaaaaaagagggatggttttccgaacaaggagcccttgtatacctcgat
acaaatagcgcaacattaaatagcgataaggcttcctacccaatagattttgttgttcct
tgcatccatggtttcccgggagaaactggggatattcaatccatgttagaactggcaggc
attccttatctaggctgtgggccagaagccagtgcaaacagctttaacaaaatcacgtcc
aaactatggtatgacgcattagatattcctaacacaccgtatctatttttaacccaaaat
acaccaagctcgattgataaagccaagcaagcttttggtcattggggaagtatctttgtc
aaagctgctcgtcagggttcttcagtcggatgctacaaagtaaccacagaagatcagatt
gcccccgccattgaggctgcttttggtttctcagagcaagttcttgtcgagcaagccgtt
aaacctagagagttagaggtttctgcttatgagatgaacggaaaactctatatctcaaaa
ccgggagaagtgattgcaccagaaggtacattctattcatatgaagaaaagtacagtgcg
aatagccacgccagaaccgtcttagaagctgaaaatctaaccgagaaacacaaagaatta
attcaaacatatgctgaacgtgtattcatccatatgaagcttcgtcatttatctcggatc
gactttttcttgactcaagagggacaaatttacctcaatgaggtcaatacatttccagga
atgacaccgatttccatgtttccgaaaatgctagagcataacggacaccgatttagtgaa
ttcctcgtgcaatgtgtcaccaacacattagtaaatgcgaagtag

DBGET integrated database retrieval system