KEGG   Vibrio cholerae 2012EL-2176: EN18_12065Help
Entry
EN18_12065        CDS       T03389                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
vcq  Vibrio cholerae 2012EL-2176
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vcq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EN18_12065
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EN18_12065
Enzymes [BR:vcq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     EN18_12065
Bacterial toxins [BR:vcq02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   EN18_12065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1:1402543..1404888
Genome map
AA seq 781 aa AA seqDB search
MRFKNVKKTALMLAMFGMATSSNAALFDYNATGDTEFDSPAKQGWMQDNTNNGSGVLTNA
DGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGWRMTTEMKVLSGGMITNYYANGTQRVL
PIISLDSSGNLVVEFEGQTGRTVLATGTAATEYHKFELVFLPGSNPSASFYFDGKLIRDN
IQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQGDVIFRGPDRIPSIVASSVTPGVVTA
FAEKRVGGGDPGALSNTNDIITRTSRDGGITWDTELNLTEQINVSDEFDFSDPRPIYDPS
SNTVLVSYARWPTDAAQNGDRIKPWMPNGIFYSVYDVASGNWQAPIDVTDQVKERSFQIA
GWGGSELYRRNTSLNSQQDWQSNAKIRIVDGAANQIQVADGSRKYVVTLSIDESGGLVAN
LNGVSAPIILQSEHAKVHSFHDYELQYSALNHTTTLFVDGQQITTWAGEVSQENNIQFGN
ADAQIDGRLHVQKIVLTQQGHNLVEFDAFYLAQQTPEVEKDLEKLGWTKIKTGNTMSLYG
NASVNPGPGHGITLTRQQNISGSQNGRLIYPAIVLDRFFLNVMSIYSDDGGSNWQTGSTL
PIPFRWKSSSILETLEPSEADMVELQNGDLLLTARLDFNQIVNGVNYSPRQQFLSKDGGI
TWSLLEANNANVFSNISTGTVDASITRFEQSDGSHFLLFTNPQGNPAGTNGRQNLGLWFS
FDEGVTWKGPIQLVNGASAYSDIYQLDSENAIVIVETDNSNMRILRMPITLLKQKLTLSQ
N
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcaaaaacgtaaagaaaaccgctttaatgcttgcaatgttcggtatggcgaca
agctcaaacgccgcactttttgactataacgcaacgggtgacactgagtttgacagtcca
gccaaacagggatggatgcaagacaacacgaataatggcagcggcgttttaaccaatgca
gatggaatgcccgcttggttggtgcaaggtattggagggagagctcaatggacatattct
ctctctactaatcaacatgcccaagcatcaagtttcggttggcgaatgacgacagaaatg
aaagtgctcagtggtggaatgatcacaaactactacgccaacggcactcagcgtgtctta
cccatcatttcattagatagcagtggtaacttagttgttgagtttgaagggcaaactgga
cgcaccgttttggcaaccggcacagcagcaacggaatatcataaatttgaattggtattc
cttcctggaagtaacccatccgctagcttttacttcgatggcaaactcattcgtgacaac
atccagccgactgcatcaaaacaaaatatgatcgtatgggggaatggctcatcaaatacg
gatggtgtcgccgcttatcgtgatattaagtttgaaattcaaggcgacgtcatcttcaga
ggcccagaccgtataccgtccattgtagcaagtagcgtaacaccaggggtggtaaccgca
tttgcagagaaacgtgtggggggaggagatcccggtgctctgagtaataccaatgacata
atcactcgtacctcacgagatggcggtataacttgggataccgagctcaacctcactgag
caaatcaatgtcagtgatgagtttgatttctccgatcctcggcctatctatgatccttcc
tccaatacggttcttgtctcttatgctcgatggccgaccgatgccgctcaaaacggagat
cgaataaaaccatggatgccaaacggtattttttacagcgtctatgatgttgcatcaggg
aactggcaagcgcctatcgatgttaccgatcaggtgaaagaacgcagtttccaaatcgct
ggttggggtggttcagagctgtatcgccgaaataccagcctaaatagccagcaagactgg
caatcaaacgctaagatccgaattgttgatggtgcagcgaaccagatacaagttgccgat
ggtagccgaaaatatgttgtcacactgagtattgatgaatcaggtggtctagtcgctaat
ctaaacggtgttagtgctccgattatcctgcaatctgaacacgcaaaggtacactctttc
catgactacgaacttcaatattcggcgttaaaccacaccacaacgttattcgtggatggt
cagcaaatcacaacttgggctggcgaagtatcgcaggagaacaacattcagtttggtaat
gcggatgcccaaattgacggcagactgcatgtgcaaaaaattgttctcacacagcaaggc
cataacctcgtggagtttgatgctttctatttagcacagcaaacccctgaagtagagaaa
gaccttgaaaagcttggttggacaaaaattaaaacgggcaacaccatgagtttgtatgga
aatgccagtgtcaacccaggaccgggtcatggcatcacccttactcgacaacaaaatatc
agtggcagccaaaacggccgcttgatctacccagcgattgtgcttgatcgtttcttcttg
aacgtcatgtctatttacagtgatgatggcggttcaaactggcaaaccggttcaacactc
cctatcccctttcgctggaagagttcgagtatcctagaaactctcgaacctagtgaagct
gatatggttgaactccaaaacggtgatctactccttactgcacgccttgattttaaccaa
atcgttaatggtgtgaactatagcccacgccagcaatttttgagtaaagatggtggaatc
acgtggagcctacttgaggctaacaacgctaacgtctttagcaatatcagtactggtacc
gttgatgcttctattactcggttcgagcaaagtgacggtagccatttcttactctttact
aacccacaaggaaaccctgcggggacaaatggcaggcaaaatctaggcttatggtttagc
ttcgatgaaggggtgacatggaaaggaccaattcaacttgttaatggtgcatcggcatat
tctgatatttatcaattggattcggaaaatgcgattgtcattgttgaaacggataattca
aatatgcgaattcttcgtatgcctatcacattgctaaaacagaagctgaccttatcgcaa
aactaa

DBGET integrated database retrieval system