KEGG   Vibrio cholerae O395: VC395_1699Help
Entry
VC395_1699        CDS       T02099                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vcr  Vibrio cholerae O395
Brite
Enzymes [BR:vcr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VC395_1699 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:complement(1780371..1780886)
Genome map
AA seq 171 aa AA seqDB search
MNQFTLFAVAAFFSSSVLAQEMTVVMTDLSSGQSVGTVTLTDSEYGTVFTPQLTGLPAGL
HGFHVHANGSCETSSKDGKTVLGGAAGGHYDPQNTGKHGYPWTNDNHLGDLPALYVDAQG
QANQPVLASRFKMAEVKGKALMVHAGGDNHSDHPMPLGGGGARIVCGVIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatttactttgtttgcggtcgccgcgtttttttcttcttcggttttggcgcaa
gaaatgaccgtagtgatgacggatttgagctctggccaatccgtgggcaccgttacctta
actgatagcgagtatggtacggtctttactccgcagttaactggcttgccagccggtttg
cacggttttcatgtacacgcgaatggctcatgtgaaacctcgtccaaagatggcaaaacc
gtattaggtggcgctgcgggtgggcattatgatccgcaaaacacgggaaaacacggctat
ccgtggaccaacgacaatcacttgggtgatctcccagctttgtacgtggatgcgcaaggc
caagcaaatcaacccgttttggcatcccgcttcaaaatggcagaggtaaaaggtaaagct
ttgatggtccacgcgggcggggataaccattccgaccatccaatgcctttgggtggcggt
ggtgcgcgcatcgtatgtggtgtgattggtttataa

DBGET integrated database retrieval system