KEGG   Verticillium dahliae: VDAG_01389Help
Entry
VDAG_01389        CDS       T03450                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
vda  Verticillium dahliae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDAG_01389
Enzymes [BR:vda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     VDAG_01389
Glycosyltransferases [BR:vda01003]
 Polysaccharide
  Storage polysaccharide
   VDAG_01389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 712 aa AA seqDB search
MSQDERSAREVKDHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGERYTLIGPLNHQSA
AVEVEELEPTVPELAATINSMKERGIGILYGRWLIEGAPRVLLFDTKTAYKFLDEWKTDL
WNVASIPSPPNDDETNEAIVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLCKKR
RIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHACDV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHEFVRGHFYG
HYDFDPENTLYFFTAGRYEFRNKGVDMFVESLARLNHRLKSAGSKMTVVAFIIMPAQTTS
LTVEALKGQAVMKSLRDTVDIIERGIGKRIFERSLKWHDGDPLPDEKELITGADRVLLRR
RLFAMKRHGLPPIVTHNMLNDSEDPILNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVLP
MDYDEFVRGTHMGIFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRMKGVDDSVNSLTSHMFDFCQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPGSFQGDEEEDTILGVEQKISRPFSVPGSPRDRSGMMTPGDFASLQEGREGLS
TEDYVAWKLPEEEDPEEYPFPLTLRTKRVGPPSPLDGVPLQPTNGNGTSSSS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagacgaacgttccgcccgtgaggtgaaggatcatctcctcttcgaaatcgca
acggaagttgcccaccgagttggcggcatctactctgtgatcaagtcaaaggcccccgtc
acgacagccgagtatggcgagcgctacaccctgatcggtccgctgaaccaccaatcggcc
gccgtcgaagtggaggagctcgagcccaccgttcctgagcttgctgccacgatcaactcc
atgaaggagcgcggtatcggcattctctatggtcgctggctgattgagggcgcaccccga
gtgctcctgttcgacaccaagactgcttacaagttcctcgatgagtggaagacggacctc
tggaacgtcgccagcattccctccccgcccaatgacgacgagacgaatgaggccatcgtt
tttggatacctggttgcatggttcctcggagagtttgtctgccacgagaagaagaaggcc
gtcattgcgcacttccacgagtggctggccggtgtcgcattgcccttgtgcaagaagcgc
cgcattgatgtgaccaccatcttcaccacccacgccacgctgctcggtcgttacctctgt
gctggctcggtcgacttttacaacaacctgcagtggttcgatgtggacgccgaggctggc
aagcgcggtatctaccacaggtactgcatcgagcgagctgctgcccacgcctgcgatgta
ttcacgaccgtgtcccacattacagcgtacgagagcgagcacctgctcaagcgcaagccc
gacggcgttctgcccaacggcctcaacgtcaccaagttctcagctgttcacgagttccag
aacttgcatcagcaggcgaaggagaagattcacgaattcgtgcgaggccatttctacggc
cactacgatttcgacccggagaacacgctgtacttcttcacggccggtcgttacgagttc
aggaacaagggtgtcgacatgtttgttgagtcgctggcacgcctcaaccaccgcctcaag
agcgctggcagcaagatgacggtcgtggccttcatcatcatgcctgcccagacgacatcg
ctgactgtcgaggctctcaagggccaggccgtcatgaagtcgcttcgggacactgttgac
attatcgagcgtggcattggcaagcgcatctttgagcgctctctgaagtggcacgacggc
gacccgctccccgatgagaaggagctgatcaccggtgctgaccgcgtcctcctgcggaga
cgcctcttcgcgatgaagaggcacggcctgcctcccatcgtcacccataacatgctgaac
gatagcgaagatcctatcctgaaccagatccgtcgggtccagcttttcaaccacccttct
gaccgagtcaaggttgtcttccacccagagttcctcaactctgccaaccccgtcctgccc
atggactacgacgagtttgtgcgtggcacgcacatgggcatcttcgcatcctactacgag
ccttggggctacaccccggccgagtgcaccgtcatgggcgttcccagcattaccacgaac
ctgtctggctttggctgctacatggaggagctcatcgagaactcgagcgactacggtatc
tacattgttgaccgccggatgaagggtgtcgatgactcggtcaactcgttgacctcgcac
atgttcgacttttgccagaagagccgtcgccagcgtatcaaccaacgtaaccgcacggag
cgtctcagcgacctgctcgactggaagaggatgggcatggagtacgtcaaggcgcgccaa
ctggcgctgcgccgggcctatcctggatcgttccagggtgacgaggaggaggacacgatc
ctcggtgttgagcagaagatctcgcgacctttctcggtgcctggatcccctcgtgaccgt
tctggcatgatgacgcctggtgactttgccagcctgcaagagggccgcgaaggcctgagc
actgaggactatgtcgcttggaagctgcctgaggaggaagaccctgaggagtaccccttc
ccgctgacgctgcgcacgaagcgtgtcggcccacctagccccctcgacggcgtgcctctg
caacccacaaacggcaacggcactagcagcagcagctag

DBGET integrated database retrieval system