KEGG   Verticillium dahliae: VDAG_01913Help
Entry
VDAG_01913        CDS       T03450                                 

Definition
(RefSeq) glucokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
vda  Verticillium dahliae
Pathway
vda00010  Glycolysis / Gluconeogenesis
vda00051  Fructose and mannose metabolism
vda00052  Galactose metabolism
vda00500  Starch and sucrose metabolism
vda00520  Amino sugar and nucleotide sugar metabolism
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
vda01130  Biosynthesis of antibiotics
vda01200  Carbon metabolism
Module
vda_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vda_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VDAG_01913
   00051 Fructose and mannose metabolism
    VDAG_01913
   00052 Galactose metabolism
    VDAG_01913
   00500 Starch and sucrose metabolism
    VDAG_01913
   00520 Amino sugar and nucleotide sugar metabolism
    VDAG_01913
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    VDAG_01913
Enzymes [BR:vda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     VDAG_01913
Membrane trafficking [BR:vda04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    VDAG_01913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 20703376
NCBI-ProteinID: XP_009656237
UniProt: G2WWC7
LinkDB All DBs
Position
7
AA seq 553 aa AA seqDB search
MALEAETKRLVSQFDFTDDHVNKAVEEFLSQMQEGLGKDGTSMSQIPTYVTGVPNGTEKG
LYLAVDLGGTNFRVCSVKLNGDTTFNLTYSKVAIPKELMVAKTATELFSFLAKQIEAFLR
EHHKDQFENSVRRRRTVSSKSGYKDEHIFRLGFTFSFPVEQLAINKGNLIRWTKGFDIPD
AIGKDVCALLQDEIDNLRLPVRVAALVNDTVGTLMARSYTANGKEGSLLGAIFGTGTNGA
YLEKLSNIKKPIQGDYDAATGEMVVNTEWGSFDNQLNVLPTTPWDTSLDKDSVNPGIQMF
EKRVSGMFLGEIVRRVVVDMIKDDKLSLFRDDNSSHNDWRSTTDVDPKSSIRKQWGLDSA
IMSVAASDNTPELSTLRQELETVLHVYTPSLEDAQAFKAIAGAVGRRAARLSAVAIAGIV
LQSGKLDDPEAEYIDIGVDGSLVEHYPFFRDMIYEALRAVNGIGSKGAEKIRIGIAKDGS
GVGAALIALVAAGMEKETSDVADFRDSVKRELDSIPTLADDSLTSNQQVAIGAGIVGAAA
VAALYWARRRNYI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgaagcggaaacgaagcgccttgtgtcgcagtttgactttaccgacgaccat
gtcaacaaggccgtcgaggagttcctctcccagatgcaggagggcctcggcaaggatggc
accagcatgagccagattcccacctacgtcacgggcgtccccaatggcaccgaaaagggc
ctttacctggccgtcgacctcgggggcaccaacttccgcgtctgctccgtcaagctcaac
ggtgacacgactttcaacctcacctacagcaaggtcgccatccccaaggagctcatggtt
gccaagacagccaccgagctgttttccttcctcgccaagcagatcgaggcgttcctgcgc
gagcaccacaaggaccagtttgagaacagcgtccgccgccgccgcactgttagctccaag
tctggctacaaggacgagcacatcttccgtctcggtttcacctttagtttccccgtcgag
cagctcgccattaacaagggcaacctgatccgatggaccaagggtttcgacatccccgac
gccatcggcaaggacgtctgcgccctgctccaggacgagatcgacaaccttcgcctgccc
gtccgtgtcgctgcgctcgtcaacgacacggttggaaccctcatggcccgctcctacacc
gccaacggcaaggagggctctctcctcggagccattttcggcaccggcaccaacggcgcc
tacctcgagaagctgtcaaacatcaagaagcccatccagggagactacgacgcggccacg
ggcgagatggtcgtcaacacggagtggggttcgttcgacaaccagctcaacgtcctgccc
acgacaccgtgggacacgtccctcgacaaggacagtgtcaaccccggcatccagatgttc
gagaagcgcgtctcgggcatgttcctcggcgagattgttcggcgggtcgttgttgatatg
atcaaggatgacaagctttcgctcttccgcgacgacaactccagccacaacgactggagg
tctaccaccgacgtcgaccccaagtcgagcattcgcaagcagtggggcttggacagtgcc
atcatgtccgtggccgcttccgacaacacgcctgagctgtccactctgcgacaggagctc
gagactgtgttgcacgtctacaccccttccttggaggacgcacaggccttcaaggctatt
gccggcgccgtcggccgccgtgccgcaagactctccgccgttgcgatcgctgggattgtc
ctgcagtccggcaaactcgacgaccccgaggccgaatacattgatatcggcgttgacggc
agcctagtcgagcactaccccttctttcgtgacatgatttacgaagcgctgcgggctgtc
aacggcatcgggtccaagggtgctgagaagattcgcattggcatcgccaaggatggcagc
ggcgttggtgccgctctcatcgcgctggtggctgcaggcatggagaaggagacgagcgat
gtggccgactttagggattccgtcaagcgcgaattggactcgatcccgacgctagcggat
gattccctgacatcgaaccagcaggttgcgattggtgctggcattgttggagcggcagcc
gtggctgccctgtactgggctaggcgacgaaactacatctaa

DBGET integrated database retrieval system