KEGG   Verticillium dahliae: VDAG_05650Help
Entry
VDAG_05650        CDS       T03450                                 

Definition
(RefSeq) trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
vda  Verticillium dahliae
Brite
Enzymes [BR:vda01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     VDAG_05650
Peptidases [BR:vda01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   VDAG_05650
Exosome [BR:vda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDAG_05650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 256 aa AA seqDB search
MVFKTLVAALGFTAVAFGSPVPAPQEELQIVGGVAASAGDFPFIVSLQRSGSHFCGGSLL
NANTVLTAAHCSTGVSASSVTVRAGSLNRSSGGTLVRVSSIVVNPGYVASRYDNDFAIWK
LATPIPTSSTISYATLAAANSDPAANTLTTTAGWGTTSSGGSTLPTALRKVDVPIISRTT
CRSYYGTSAVTTNMICAGFAAGGKDSCQGDSGGPIIEASSRTLVGVVSWGEGCAAPNAPG
VYARVGAARTFINQYL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggttttcaagactctcgtcgccgctctcggcttcaccgccgtcgcctttggctccccc
gtccctgccccccaggaggagctccagatcgttggcggagttgcggccagcgctggagac
ttccccttcatcgtctccctgcagaggagcggctcgcacttctgcggcggatccctcctg
aacgccaacaccgttttgaccgccgctcactgcagcaccggcgtcagcgcttcctccgta
actgtccgcgccggcagcctgaaccgcagctccggtggcactcttgtccgcgtctcctcg
atcgtcgtcaaccccggctacgtcgcctcgaggtacgacaacgacttcgccatctggaag
ctcgctacccccatccccacgagctccaccatcagctacgccaccctggccgctgccaac
tcggaccccgctgccaacactctcaccaccaccgctggctggggaactacctcgtccggc
ggcagcaccctccccaccgccctgaggaaggttgacgtccccatcatctcccgcaccacc
tgccgctcctactacggcacctctgccgtcaccaccaacatgatctgcgccggcttcgct
gccggtggcaaggactcctgccagggtgactccggcggtcccatcatcgaggccagctcc
aggactctcgtcggtgtcgtctcttggggtgagggctgcgctgctcccaacgctcctggt
gtctacgcccgcgttggcgccgcccgcaccttcatcaaccagtacctttaa

DBGET integrated database retrieval system