KEGG   Verticillium dahliae: VDAG_08979Help
Entry
VDAG_08979        CDS       T03450                                 

Definition
(RefSeq) URE2 protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
vda  Verticillium dahliae
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vda00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VDAG_08979
Enzymes [BR:vda01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VDAG_08979
Transporters [BR:vda02000]
 Other Transporters
  Pores ion channels [TC:1]
   VDAG_08979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 218 aa AA seqDB search
MSSLKPITLYGHAGPNPWKVVMILEELGVPYVTENVDFSVVKQEPYTLLNPNGRVPTIVD
PNTNITLWESGAIIEYLIETYDKEEKLSISSFPEKHHLRQFLHFQASGQGPYFGQAVWFA
KFHPEDLPSAKERYVEQTVRVLSVLDKLLEGKEYLVGNKCTYADIAFVNWNATAENVILK
SDWDEKVEKKYPNFVAWHRRVTERPIIKDVLQRQAAGR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactcaagcctattacgctctatggacatgccggacccaatccgtggaaggtc
gtcatgatcctggaagaactcggcgtcccctatgtgacggaaaacgtcgacttctccgtc
gtcaagcaggagccctataccctcctcaacccgaacggccgcgtgcccaccattgtcgac
cccaacacaaacatcacgctctgggagtcgggtgccatcatcgagtacctcatcgaaacg
tacgacaaggaggaaaagctcagcatctcgagcttccccgagaagcaccaccttcgccag
ttcctccacttccaggcctcgggccaggggccctactttggccaggctgtgtggttcgcc
aagttccatcccgaggaccttccctcggccaaggagcggtacgtcgagcagacggtgcgc
gtcctctcggtgctcgacaagctactggagggaaaggaatatctcgtcggcaacaagtgc
acgtacgccgacattgcctttgtcaactggaacgccacggccgagaacgtgattctcaag
tcagattgggatgagaaggtggagaagaagtaccccaactttgtggcatggcaccggcgg
gttactgagaggccgatcatcaaggacgtactgcagaggcaggcagccggtcgctga

DBGET integrated database retrieval system