KEGG   Vibrio diabolicus: AL552_22655Help
Entry
AL552_22655       CDS       T05332                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vdb  Vibrio diabolicus
Pathway
vdb00620  Pyruvate metabolism
vdb00680  Methane metabolism
vdb01100  Metabolic pathways
vdb01120  Microbial metabolism in diverse environments
vdb01200  Carbon metabolism
Module
vdb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vdb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL552_22655
  Energy metabolism
   00680 Methane metabolism
    AL552_22655
Enzymes [BR:vdb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL552_22655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AVF96292
UniProt: A0A2L1ZNH2
LinkDB All DBs
Position
1:2745483..2748116
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVRMLGHLLGNTIRDAHGEEIFEKVETIRKLSKSAQAGNQADRDSLIEEI
KHLPNEQLTPVTRAFNQFLNLTNIAEQYHTISRHCEEHICEPDAINSLFSKLVQNDVSKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSSKERKKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMHDRLKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVSNDQVR
ELAGEDQHEPYRAILKQLRSLLNETKDILDAKIHGQKLAIKAPLQKVEQLWEPLYACYQS
LNECGMGVIANGSLLDTLRRVKAFGIHLVRLDIRQESTRHSDVLSELTRYLGIGDYEQWS
EQDKIAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIIAAQPREAFGAYVISMARTASD
VLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIKQLMGIDLYRGFIQNHQMVMIGYS
DSAKDAGVMSAGWAQYHAMESLVKVAEEEGVELTLFHGRGGTVGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQEWRDLMEVLSE
VSCESYRNVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPKGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSIDKGHQALLEEMCREWPFFSTRLGMLEMVYSKCNIDISRYY
DERLVDESLRPLGEKLRAQLQEDIKAVLNVENNENLMQHDPWGLESIRLRNIYVEPLNML
QAELLYRTRQTEEASANLEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatacgccgcactcaaaagtaatgtgcgcatgttaggccacttattgggt
aacaccattcgcgatgcccatggcgaagaaatcttcgagaaagtggaaaccattcgtaaa
ttatccaaatcagctcaagcaggaaatcaagcagacagggacagcttgatcgaagaaatc
aaacatttacctaatgagcaactaacgcccgttacccgtgcgtttaaccaatttctaaat
ctcaccaatattgctgagcaataccacacgatttcacgccactgtgaagaacacatctgt
gaaccagacgcgattaactcgctgttttctaaactggtacaaaacgatgtgagcaaactg
gacactgcgcaagcggttcgtgatctgaatattgaattggtattgacggctcacccaacg
gaaatcacgcgtcgcacgatgatcaacaaattggtcaagatcaacgagtgcttatcaaag
ttggaactgagtgatctttcttctaaagagcgcaagaaaaccgagcgtcgcttagagcaa
cttatcgcacaaagctggcattctgacgtaattcgtcaacaacgccctactccattggat
gaagcgaaatggggttttgccgtagtagaaaactcactgtgggaagcagtgccagacttc
ttacgtgaaatgcacgatcgcttgaaatcttacttgggtgaaggtttaccaattgatgct
cgcccagtgcacttctcttcttggatggggggtgaccgcgacggtaacccgttcgtcact
catagcgtgacgcgtgaagtattgcttctgtctcgttggaaagccgcagatctttatctc
aatgacatcaacgagttgatcagtgaactgtctatgacggtttcaaacgatcaagttcgt
gaacttgctggcgaagatcagcacgaaccatatcgtgcgatcctgaaacaacttcgctca
ctattgaacgaaaccaaagatattctcgatgctaaaatccatggtcaaaaactggccatt
aaagctccgttgcaaaaagtcgagcaactttgggaacctctgtatgcctgttaccagtcg
ctaaatgaatgtggcatgggtgtgatcgcaaatggctctctactagatacattgcgccgc
gtaaaagcatttggtattcatcttgttcgccttgatatccgccaagagagcacgcgtcat
tcagacgtattgtctgaattaacccgctacttaggcattggtgattacgaacaatggagc
gagcaagataagattgctttcctaaccaacgaactcgcatctaaacgtcctcttctgcct
cgtgattgggaaccatcagaacctgtcaaagaggttttggacacctgtaagattattgca
gcacaaccgcgtgaagcattcggtgcctacgttatttctatggcacgcactgcatcggat
gtgttagcagtccacctacttctgcaagaagctggctgcccatatcgtatggatgtttgc
ccattattcgagacgctagacgacttgaacaatgcagaatcggtcatcaaacagctgatg
ggtatcgacctataccgtggctttatccaaaaccaccaaatggtcatgattggttactct
gactcagcgaaagatgcgggtgtcatgtctgcaggctgggctcagtaccatgcgatggag
tcgttagtaaaagtggcggaagaagaaggtgttgaactgactctattccacggtcgtggc
ggtacagtaggccgcggcggcgcgccagcacacgcagcacttctgtctcaaccaccaaaa
agcttgaaaggtggtttgcgcgtaacagaacagggcgagatgatccgctttaaactgggc
cttccagatgtcgccgtaaacagttttaacctttacgcgagcgcgattctagaagctaac
ctattgccaccaccagagccaaaacaagaatggcgcgacttaatggaagtgctatcagaa
gttagctgcgagtcttatcgcaacgtagttcgcggcgagcctgattttgtgccttacttc
cgtcaagcgacaccagagctcgagctcggtaagttgccacttggctctcgtcctgcaaaa
cgtaatccgaagggcggagtggaaagcttacgtgcaatcccgtggatcttctcgtggagc
caaaatcgtttggtacttccagcatggttaggtgcgggtgaagcaattcaatactcgatc
gataaaggtcaccaagcgctgctcgaagagatgtgtcgtgaatggccgttcttctcgact
cgccttggcatgttagaaatggtgtactcgaagtgtaatatcgatatttctcgctattac
gatgagcgattggtggatgaatcactccgtccactcggtgaaaagcttcgcgctcagctt
caagaagatatcaaagcagtactgaatgtagagaacaacgaaaacttgatgcagcatgac
ccttggggactcgaatcaattcgcttgcgcaacatctacgttgagccattgaacatgcta
caagccgagttgctataccgtacacgccaaaccgaagaagcatctgcaaacctagaagaa
gcactaatggtgacaattgctggtattgcagctggcatgcgcaacacaggctaa

DBGET integrated database retrieval system