KEGG   Vibrio sp. EJY3: VEJY3_20346Help
Entry
VEJY3_20346       CDS       T01683                                 

Definition
(GenBank) acyltransferase
Organism
vej  Vibrio sp. EJY3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1014251..1017079
Genome map
AA seq 942 aa AA seqDB search
MSDQNDTTSRDSENIAQTVLEIVRDLKLELDPEGLSSVSIHLKSDLDHDLCLDSLTRAEL
ITRIESRFDVSLPDHALSSISTPEDIIGEILTAGSSNKTAYLDESAKAIKLDSVHQLPTE
VKTLQALLDWHVEHHPDRPHLYVYQNADEVVEVSYKQLKQQALKISAGLIDAGVEAGDCV
AIMLPTCTDYFYSFFAILYARAVPVPIYPPARIEHVEDHLNRHASILNNAQAKLLITVPE
AKPVAHLLKLQVPSVDAVVTANDLQKDTSFPDMGEAKTDDIAFLQYTSGSTGVPKGVTLT
HANLLANIRAMGRVINAKSDDVFVSWLPVYHDMGLIGAWLGSLYHAIPLVIMSPLLFLTK
PQRWLWAIHHHRGTLSPAPNFAYELCVSRVKESDLEGLDLSSWRLSWNGAEPVSPQSIQN
FSEKYAKYGFKPETMSPVYGLAESSVGLTFPVTVREPRIEYFQRASLSQFGRAVLAQQED
EDTIPFIGLGYPLPEHQIRIVDDLGKELPDGEEGALEFQGPSATQGYYRNPEKTKALYHD
GWLVTGDRAFTLGGELFITGRSKDIIIKAGRNIYPHELEQAVGSIDGIRKGCVAAFGSHD
AHSGTEKLIVLAESRETSKDKVKQLKRKINQLSLKLLGNPVDDVIIGPPHSIPKTSSGKI
RRSACKDLHERGSFAKQHRALWLQTLNLALAGIMPQLRKYMRILLDIAYAAYSWLVLGIL
APIVWLLVAVLPNKVMCWKIAQFGAKALMGLTGTKCTIEGKEHLPAANAPCIFVVNHCSY
LDGLVIVAVSELPCRFVAKSELLNNPFTRIFLSKLGTEFVDRFDVEKSVVDAKRLAFEAE
DCQPMVVFPEGTLYRMSGLHPFHMGAFIAAASSQVPVSPITLRGTRSKLRGNSLFPRRGD
ISVTIGEPLFPNGNDWNAALELRNKARSEILTHCGEPDMARS
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaaaatgacactacaagtagagactctgaaaacatcgcgcaaactgtatta
gagatcgttcgggatctaaaacttgaactagaccccgaaggtctctcatccgtttctatt
cacttaaaaagtgacctcgaccatgacctttgtttggatagcctaacgcgtgctgagcta
atcacacgtatagaaagtcgtttcgacgtgtcacttcctgatcacgcattgtccagcata
tcgacaccagaagatattatcggcgagattttaacggcaggatcatcaaataaaacagcc
tacttagatgagtcggcgaaagcgatcaaactcgactcagtccatcagttaccaactgag
gtcaaaacgctacaagcgctactcgactggcatgtggaacatcacccggatcgccctcat
ctttacgtttatcaaaacgctgatgaagtggtagaagtcagctataaacaactaaaacaa
caagctctcaaaatctccgctgggctaattgacgcgggagttgaagctggggactgcgtc
gcaatcatgttgccaacctgtaccgactacttctacagcttttttgcaatactttacgcc
agagcagtgcctgttcccatttatccaccagcccgaattgaacatgtcgaagatcatttg
aatcgtcacgccagtattctcaacaatgctcaggcaaaactattgattacggtgccagag
gcaaaacctgtggcccacttacttaaattacaagtaccgtctgttgatgccgtcgttacc
gcgaatgatttgcaaaaagacaccagcttccccgatatgggtgaagctaaaaccgacgat
attgcttttttgcaatacacatccggaagtacgggtgtacctaagggcgtgacccttacc
catgcgaacttactcgctaatatccgcgcaatgggtagagtcattaacgccaagtcggac
gatgtgtttgtgagttggctgcctgtctaccacgatatgggactcattggagcatggctt
ggtagcttgtatcatgcgatcccactggtgatcatgtcgcccttgctcttcttaactaaa
cctcagcgatggctatgggcgattcatcatcatcgaggcaccctttctcccgcaccaaac
ttcgcctatgagctttgtgtttctcgagtgaaggaaagcgatcttgaagggctcgattta
agcagttggcggctttcctggaacggcgcagagcccgtgagtccacaatcgatccaaaac
ttctctgaaaaatacgccaagtatggatttaagccagaaaccatgtcgcctgtgtatggg
ctagcggaatcctcggtcggactgacattcccagtgaccgtccgcgaaccacgtattgag
tatttccaacgagcatcgttaagccagtttggtcgtgctgtactcgcccaacaggaagat
gaagataccattccgtttattggcttaggctacccacttcccgagcatcaaattcgtatc
gttgatgatctgggcaaagaattacccgatggagaagaaggcgcacttgagtttcagggc
ccgtccgccacccagggttactatcgaaacccagaaaaaaccaaagcgctatatcatgat
ggttggctggtaacaggggaccgcgcgtttacattaggcggcgagctttttatcaccgga
cgtagcaaagatatcattatcaaagccgggcgtaatatctatcctcatgagctggaacaa
gcggtagggagtattgatggtattcgcaaaggttgtgtggccgcgtttggtagccacgac
gcgcactccggtacggagaaactgatcgtgttggcggaaagccgagaaaccagtaaagac
aaagtcaaacagctaaagcgtaaaattaaccaactctctctaaaactacttggtaacccc
gtcgatgatgtcattatcggcccgcctcactccattccaaaaacgtccagtgggaaaatt
cgtcgcagtgcgtgtaaagatctgcatgaacgtggatcctttgcgaagcagcatcgggct
ttgtggttacaaaccctgaatctcgccttagcgggcatcatgccgcaactgcgtaaatac
atgcgaatccttttagacatcgcctacgcggcctattcgtggttagtgttgggaatactt
gctcctatcgtctggttacttgttgccgtcttacccaacaaagtcatgtgctggaagata
gcccagtttggtgccaaagcacttatgggacttactggcaccaagtgcaccatcgaagga
aaggaacacttaccagcagcaaatgccccctgtatttttgtcgttaatcattgtagttat
cttgatgggctggtgatcgtcgcagtttcagaattgccttgtcggtttgtggcaaaaagt
gagttactcaataatccatttacccgaatcttcttaagcaaactcggtacggagtttgtt
gaccggtttgatgtagaaaaaagcgtggtggacgctaagaggctggcttttgaagctgaa
gactgtcagccaatggtcgtatttcctgaaggaacattatatcgaatgtctggccttcat
ccgtttcatatgggcgcctttattgctgccgcaagctcacaagtgccagtcagcccgatt
accttacgtggtacgcgctctaaactcagaggtaactctcttttcccacgtagaggcgac
atcagtgtaaccattggtgaaccactcttccccaatggtaatgactggaacgcagcgctt
gaacttcgcaataaagcccgatcagagatcctcacccactgtggtgagccagatatggca
cgcagttag

DBGET integrated database retrieval system