KEGG   Vibrio sp. EJY3: VEJY3_23531Help
Entry
VEJY3_23531       CDS       T01683                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vej  Vibrio sp. EJY3
Brite
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VEJY3_23531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1752217..1752738
Genome map
AA seq 173 aa AA seqDB search
MLKGLLRISAPVTLIGMIAPAAIAQSITMTDLNTNKSVGTVELSESQYGVVFSPQLTSIP
AGLHGFHVHVNPSCESAEKDGKNVLGGAAGGHYDPQNTGKHGYPWTDDNHLGDLPPLYAD
MEGNAVSPVVAPRLKLSDLKGRALMIHAGGDNHSDQPAKLGGGGARIVCGVIE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggattactgcggatttctgcacccgtaacattgattggaatgatcgcacct
gccgctatcgctcaatcgatcaccatgactgatctcaataccaacaaaagcgttggtacg
gttgagctatcagagagtcaatacggcgttgtattttcgcctcaattgaccagtatccct
gcagggctacatggctttcacgtgcatgtaaacccatcttgtgaaagtgcagaaaaagac
ggaaaaaacgtcttaggcggtgcagctggcggccattatgatccacaaaataccggaaaa
catgggtatccgtggacagacgataaccaccttggcgatcttcctcccttgtatgcggat
atggaaggaaatgccgtttcacccgtcgttgcaccacgcctaaaactgtccgatttgaaa
ggccgagccctgatgatacatgcaggtggggataaccattccgatcaaccagcgaaactc
ggtggtggtggggcccgcattgtttgtggcgtaattgagtaa

DBGET integrated database retrieval system