KEGG   Vibrio antiquarius: VEA_000056Help
Entry
VEA_000056        CDS       T01107                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vex  Vibrio antiquarius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VEA_000056
Enzymes [BR:vex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VEA_000056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:64140..65663
Genome map
AA seq 507 aa AA seqDB search
MKTFKLKRTILPLTLLLSSSALAAGNGTMMQYFHWYVPNDGTLWTQVENNAPTLAENGFT
ALWLPPAYKGAGGSNDVGYGVYDMYDLGEFDQKGSVRTKYGTKDQYLSAINAAHNNNIQV
YGDVVFNHRGGADGKSWVDTKRVDWNNRNIELGDKWIEAWVEFDFPGRNDKYSNFHWTWY
HFDGVDWDDAGKEKAIFKFKGEGKAWDWEVSSEKGNYDYLMYADLDMDHPEVKQELKDWG
EWYINMTGVDGFRMDAVKHIKYQYLQEWIDHLRWKTGKELFTVGEYWNYDVNQLHNFITK
TSGSMSLFDAPLHMNFYNASKSGGSYDMRQIMDGTLMKDNPVKAVTLVENHDTQPLQALE
STVDWWFKPLAYAFILLREEGYPSVFYADYYGAQYSDKGHDINMVKVPYIEELVTLRKDY
AYGKQHSYLDHWDVIGWTREGDAEHPHSMAVIMSDGPGGSKWMFTGKPSTRYVDKLGIRT
EDVWTDANGWAEFPVNGGSVSVWVSVE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttaaattaaaacgcactattttacctttaaccttgttgctaagttcatct
gcattggctgctgggaatggcacaatgatgcagtatttccattggtatgtgcctaacgat
ggcacactgtggactcaagtggaaaataacgctccaacgctagcagaaaacggattcaca
gcgctctggctaccacctgcatacaaaggagcgggtggcagtaatgatgtcggctacggc
gtttatgacatgtacgacttgggagagtttgatcaaaaaggatcagtgcgcaccaaatac
ggcacgaaagatcagtatcttagcgctatcaatgccgctcacaacaacaatatccaggtt
tatggtgacgtggtgtttaaccaccgtggtggtgcggatggaaaatcttgggttgatact
aagcgggtagattggaacaaccgcaacattgaacttggcgataaatggattgaagcgtgg
gtggagtttgatttccctggacgcaacgacaagtactctaacttccattggacttggtac
cattttgatggcgtggactgggacgatgcaggtaaagaaaaagccatctttaagttcaaa
ggtgaaggtaaggcatgggattgggaagtcagttctgaaaaggggaattacgactacctt
atgtatgctgacttagacatggatcatcctgaagttaaacaagaactgaaagattggggt
gagtggtacatcaacatgactggtgttgatggctttagaatggatgcggtgaagcacatc
aaataccaatatcttcaagaatggattgatcacctacgttggaaaacagggaaagaacta
ttcacggtcggagagtactggaactacgatgtgaatcagctgcataactttatcaccaaa
acttctggcagcatgtctctattcgacgcaccgttacatatgaacttctacaatgcgtct
aaatcgggtggtagctacgatatgcgtcaaatcatggatggtacgctgatgaaggacaat
ccagtcaaagcggtaaccttagtagaaaaccatgatactcaacctttgcaggcgttggag
tcgacggttgattggtggtttaagccgctcgcttacgcgtttatcttattgcgtgaagaa
ggttatccatccgtgttttatgcagattactacggcgcgcagtacagtgataaagggcat
gacatcaatatggtcaaagtgccttacatcgaagagctcgtaacactgcgtaaagactat
gcgtatggcaaacaacattcttatctcgaccattgggatgtaattggctggactcgcgag
ggcgatgcagaacatccacattcaatggcagtgatcatgagtgatggaccaggtggctcg
aagtggatgtttacgggcaagccaagtacacgctatgtcgacaagttgggcatccgaact
gaggacgtttggacagatgcgaacgggtgggctgagttccctgtaaatggtggatctgtc
tcggtttgggttagcgttgagtaa

DBGET integrated database retrieval system