KEGG   Vibrio antiquarius: VEA_001376Help
Entry
VEA_001376        CDS       T01107                                 

Definition
(GenBank) glycosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vex  Vibrio antiquarius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VEA_001376
Enzymes [BR:vex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VEA_001376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:1556101..1557450
Genome map
AA seq 449 aa AA seqDB search
MSGSQEIQSFGANVILHAFDWKYADIAQRAKEIHELGYGSVLVSPPMKSAHDDRWWQRYQ
PQDYRVIDNALGDTKDFIRMVRELEQVGVWVYADVVFNHMANEAHLRRDLQYPRQEVLEE
YQQNKQKYQSLTLFGDLSQPLFDEEDFVEAFGIKDWKDKWQVQNGRITGGPTDPGLPTLR
VCDHVVEQQRAYLKALKAIGVKGFRIDAAKHMTLEHLKRVWTDDITRDVHIFGEIITDGG
ATEEEYQLFLEPYLQETRLGAYDFPLFSTIFKAFAKKGSFKSLIDPYCFGQALSPGRAIT
FVVTHDIPNNDVFLDLIMDEENEWLAYAYILGRDGGVPLVYTDLNTSGITDKNGKPRWQG
AWNDPRMAKMIQFHNMTHGESMSVLEGNDDMLVLKRGSKGIVVLNKSQRQQSLALKMDGD
WVDLMTDQDVPSDGKLIVPPKASMLLVEN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctcacaggaaatacaatcattcggtgcgaatgttatcttacatgcgtttgat
tggaagtatgctgacattgcccaacgagcaaaagaaatccacgagctaggttacggctcc
gtgttggtttcgccaccaatgaaaagcgcccacgatgatcgctggtggcagcgctatcaa
cctcaagattaccgtgtcatcgacaatgcgttgggtgataccaaagactttatccgtatg
gttcgtgaactggagcaagttggcgtgtgggtttacgctgacgtggtgtttaaccatatg
gcaaatgaggcccaccttcgccgagacctccaatacccaaggcaagaggtcctggaggaa
taccaacaaaacaaacagaaatatcagtcgctaacgttatttggcgacttatctcaaccg
ctttttgatgaagaggactttgttgaagcgttcggtattaaagactggaaagataaatgg
caggtacaaaatggacgcatcactggtggaccaactgatcctggcttgccaaccctccgt
gtttgtgaccatgtcgttgagcagcaacgcgcttacctaaaagcactgaaagccattggt
gtgaaaggttttcgtattgatgccgcgaaacacatgacgttagagcatcttaaacgtgtt
tggacagatgacatcacgcgcgatgtgcatatatttggcgaaattattaccgatggcggt
gcgacagaagaagagtatcagttgtttcttgagccgtatttacaggaaactcgcttaggc
gcttacgatttcccgttgttctcgaccatttttaaggcgtttgctaaaaaaggcagtttc
aagtcgttgattgacccatactgtttcggtcaggccctttcgcctggtcgcgccattaca
tttgttgtcacgcatgacattcctaacaatgacgttttccttgatctgatcatggatgag
gaaaacgaatggttagcttatgcctacattctaggccgcgatggtggtgtgccattggtt
tataccgacttaaacactagcggtattacagataaaaatggcaaaccaagatggcaaggc
gcatggaacgatccgcgaatggcgaaaatgatccagttccacaatatgacgcatggcgag
tcgatgagtgttcttgaaggtaacgatgatatgctggtacttaagcgagggagcaaaggc
attgtcgtgcttaataaatcgcagcgtcagcagtctttggcattgaaaatggatggcgac
tgggtggatttgatgacggatcaggacgttccatctgacggtaagttaattgtgccacct
aaagcctcaatgttgctcgtcgaaaactaa

DBGET integrated database retrieval system