KEGG   Vibrio antiquarius: VEA_003759Help
Entry
VEA_003759        CDS       T01107                                 

Definition
(GenBank) glutamate decarboxylase eukaryotic type
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
vex  Vibrio antiquarius
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VEA_003759
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VEA_003759
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VEA_003759
   00430 Taurine and hypotaurine metabolism
    VEA_003759
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VEA_003759
Enzymes [BR:vex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VEA_003759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:2378618..2380264
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSSPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQSDTFYDQWMHSANHSLGAFCSGGTIANITA
LWVARNKALRANGSFKGVEKEGLFKAMKHYGYDGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKAKIVELEKQNIKPIAVIGVAGTTETGNVDPLPEIAEVCQAHG
CHFHVDAAWGGATLMSNHHRHLLNGVEMADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPFIREALAKAEGSQKEQLNELINELTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTKEILSSVLDEQREIAKQAPNLMERIQQ
VVTDIQSS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttgctaaagatcttcact
gtcccagaaggtcctgactcaacgttaaccaaaattgacgagagcctctcgcgaaatcta
aatcaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgcgaaatcgaaaaa
gacttttcttctgctcagattcctgagcagccagagttcgtgtcagatcatacagaacac
ttactcgacactttggtgtcgcactccgttcacacttcttcaccaagcttcattggtcat
atgacatcggcgctgccttatttcttgatgccactgtcaaagatcatgatcgccttaaac
caaaacctggtaaagatagagacttctaaagcctttaccccgcttgaacgtcaagttttg
ggcatgctacatcgcttgatctatggtcagagcgatacgttttacgatcagtggatgcat
agcgcaaaccactcattgggcgcattttgctccggcggtaccattgccaatatcactgca
ctttgggtagcacgtaacaaggcgttaagagccaatggttcatttaaaggcgttgagaaa
gaaggcctatttaaagccatgaagcattatggctacgatggcttagcggtattggtgtct
gagcgtggtcactactcccttaagaaagcagccgatgtactaggtctaggtcaagaaggc
ttggttgcggttaaaacggatgccaacaaccgtattattgtcgacgaccttaaagcgaaa
attgttgaactagagaaacaaaacatcaagcctattgctgttattggtgtagctggtaca
acagagacaggtaatgtcgacccgctacctgaaatcgcagaagtctgccaagctcacggt
tgtcatttccatgtggatgccgcatggggtggcgcaacacttatgtctaatcaccaccgt
caccttcttaacggtgtggaaatggcagactcagtaaccattgatgcgcacaagcaactc
tacatcccgatgggcgctggtatggttctgttcaaagaccctgacgcaatgaaatccata
gagcatcacgctcaatatatcttgcgtaaaggctcaaaagacctaggcagccatacatta
gaaggctctcgttcgggcatggcaatgttagtctatgccgcaatgcacatcatcagccgc
cctggctatgagctgctgatagaccaaagcattgaaaaagctcgctactttgcggattta
atcaagcaacaagatgatttcgaattggtttctgaaccagagctttgtctgctcacatac
cgctacttgccgccattcatccgtgaggcattagcaaaagcggaaggttcacaaaaagaa
caactgaatgaactgattaatgaattaacacagtttattcaaaagcgtcagcgtgaaacg
ggcaaatcgtttgtttcacgtacaagactgaacccagaccaatggcagcgcatgaacacg
attgtgttccgagtggttttggcgaatccgctgacgaccaaagaaattttgagttcggtg
cttgatgaacagcgtgaaatcgccaagcaagcaccaaatttgatggaaagaattcagcag
gtggtcactgatatccaatcgtcttaa

DBGET integrated database retrieval system