KEGG   Aliivibrio fischeri ES114: VF_1249Help
Entry
VF_1249           CDS       T00236                                 

Definition
(RefSeq) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    VF_1249
Enzymes [BR:vfi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     VF_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:1389615..1390529
Genome map
AA seq 304 aa AA seqDB search
MKNNDIKLSIPNIRRSRLINVIKSHGCIRILETHNPISALIAEKASANDIDSEENVEYQG
FWSSSLTDSVSQGKPDIELLDIKNRISNISDIFEVTSKPLIIDGDTGGKIEHLSFNIRSL
ERLGVSAIIIEDKTGLKKNSLLGNEVEQKQDTIESFCTKIKKGKESQLTEEFMIIARVES
LILDAGMEDALERAFAYSESGADGIMIHSRHQDGKEIFDFAKQYRSKYPDKILVCVPTSY
NEIKFDELKQAGFNIVIYANHMLRAAYKAMEYTSEQILKNGRTSEIESHFLSIKRMLDLV
PGTR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatgacataaaactatcgattcctaacattagacgttcaagattaataaat
gtaataaaatcgcatggttgcatcagaatattagaaactcataatccaatctcagcactt
atagcagagaaagccagtgctaatgatattgattctgaagagaatgttgaatatcaaggt
ttttggtcaagttcattaactgattcggtaagtcaaggtaagccagatattgagttgctt
gacattaagaacagaatctcaaatataagcgatatatttgaggtaacttccaaacctcta
attatagatggtgatactggagggaaaattgaacatttatcattcaacataaggtctctt
gagcgacttggcgtgtcagcaattataattgaagataaaacagggcttaagaaaaactca
ttattaggtaatgaggttgaacagaagcaagatacaatagaatcattctgcacaaaaata
aaaaaaggtaaagaatctcaattaacagaagaatttatgattattgcaagggttgaaagc
ttaattctagatgctggaatggaggatgcattagaaagagcttttgcttatagtgaaagt
ggtgctgacggaataatgatccacagtcgacaccaagatggaaaggaaatatttgatttt
gcgaaacaatatagatctaagtatccagataagatattagtatgcgtacctactagttac
aatgaaataaaattcgatgaacttaaacaagctggcttcaatattgttatttatgcaaat
cacatgctaagagcagcatataaggctatggaatatacatctgagcaaatacttaaaaat
ggaagaacatctgaaatagaatctcactttctatcaataaaaagaatgctagatctcgtg
cctggaactcggtaa

DBGET integrated database retrieval system