KEGG   Viruses: 155971Help
Entry
155971            CDS       T40000                                 

Gene name
env, HIV1gp8
Definition
(RefSeq) Human immunodeficiency virus 1; Envelope surface glycoprotein gp160, precursor
  KO
K19287  
envelope glycoprotein gp160
Taxonomy
TAX:11676 [GN:T40001]
  Lineage
Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus group
Taxonomy
Organism
vg  Viruses (Human immunodeficiency virus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RS: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
NC_001802:5771..8341
AA seq 856 aa AA seqDB search
MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKA
YDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCV
KLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLD
IIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCT
NVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPN
NNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTII
FKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRI
KQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWR
SELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQ
ARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSG
KLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQEL
LELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTH
LPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTR
IVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAI
RHIPRRIRQGLERILL
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgaaggagaaatatcagcacttgtggagatgggggtggagatggggcaccatg
ctccttgggatgttgatgatctgtagtgctacagaaaaattgtgggtcacagtctattat
ggggtacctgtgtggaaggaagcaaccaccactctattttgtgcatcagatgctaaagca
tatgatacagaggtacataatgtttgggccacacatgcctgtgtacccacagaccccaac
ccacaagaagtagtattggtaaatgtgacagaaaattttaacatgtggaaaaatgacatg
gtagaacagatgcatgaggatataatcagtttatgggatcaaagcctaaagccatgtgta
aaattaaccccactctgtgttagtttaaagtgcactgatttgaagaatgatactaatacc
aatagtagtagcgggagaatgataatggagaaaggagagataaaaaactgctctttcaat
atcagcacaagcataagaggtaaggtgcagaaagaatatgcatttttttataaacttgat
ataataccaatagataatgatactaccagctataagttgacaagttgtaacacctcagtc
attacacaggcctgtccaaaggtatcctttgagccaattcccatacattattgtgccccg
gctggttttgcgattctaaaatgtaataataagacgttcaatggaacaggaccatgtaca
aatgtcagcacagtacaatgtacacatggaattaggccagtagtatcaactcaactgctg
ttaaatggcagtctagcagaagaagaggtagtaattagatctgtcaatttcacggacaat
gctaaaaccataatagtacagctgaacacatctgtagaaattaattgtacaagacccaac
aacaatacaagaaaaagaatccgtatccagagaggaccagggagagcatttgttacaata
ggaaaaataggaaatatgagacaagcacattgtaacattagtagagcaaaatggaataac
actttaaaacagatagctagcaaattaagagaacaatttggaaataataaaacaataatc
tttaagcaatcctcaggaggggacccagaaattgtaacgcacagttttaattgtggaggg
gaatttttctactgtaattcaacacaactgtttaatagtacttggtttaatagtacttgg
agtactgaagggtcaaataacactgaaggaagtgacacaatcaccctcccatgcagaata
aaacaaattataaacatgtggcagaaagtaggaaaagcaatgtatgcccctcccatcagt
ggacaaattagatgttcatcaaatattacagggctgctattaacaagagatggtggtaat
agcaacaatgagtccgagatcttcagacctggaggaggagatatgagggacaattggaga
agtgaattatataaatataaagtagtaaaaattgaaccattaggagtagcacccaccaag
gcaaagagaagagtggtgcagagagaaaaaagagcagtgggaataggagctttgttcctt
gggttcttgggagcagcaggaagcactatgggcgcagcctcaatgacgctgacggtacag
gccagacaattattgtctggtatagtgcagcagcagaacaatttgctgagggctattgag
gcgcaacagcatctgttgcaactcacagtctggggcatcaagcagctccaggcaagaatc
ctggctgtggaaagatacctaaaggatcaacagctcctggggatttggggttgctctgga
aaactcatttgcaccactgctgtgccttggaatgctagttggagtaataaatctctggaa
cagatttggaatcacacgacctggatggagtgggacagagaaattaacaattacacaagc
ttaatacactccttaattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaatta
ttggaattagataaatgggcaagtttgtggaattggtttaacataacaaattggctgtgg
tatataaaattattcataatgatagtaggaggcttggtaggtttaagaatagtttttgct
gtactttctatagtgaatagagttaggcagggatattcaccattatcgtttcagacccac
ctcccaaccccgaggggacccgacaggcccgaaggaatagaagaagaaggtggagagaga
gacagagacagatccattcgattagtgaacggatccttggcacttatctgggacgatctg
cggagcctgtgcctcttcagctaccaccgcttgagagacttactcttgattgtaacgagg
attgtggaacttctgggacgcagggggtgggaagccctcaaatattggtggaatctccta
cagtattggagtcaggaactaaagaatagtgctgttagcttgctcaatgccacagccata
gcagtagctgaggggacagatagggttatagaagtagtacaaggagcttgtagagctatt
cgccacatacctagaagaataagacagggcttggaaaggattttgctataa

DBGET integrated database retrieval system