KEGG   Viruses: 3783681Help
Entry
3783681           CDS       T40000                                 

Gene name
BALF5
Definition
(RefSeq) Human gammaherpesvirus 4; DNA polymerase
  KO
K18964  
Herpes virus DNA polymerase catalytic subunit [EC:2.7.7.7]
Taxonomy
TAX:10376 [GN:T40079]
  Lineage
Viruses; dsDNA viruses, no RNA stage; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Taxonomy
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RS: 
UniProt: 
LinkDB All DBs
Position
NC_007605:complement(153241..156288)
AA seq 1015 aa AA seqDB search
MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTV
VGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYV
VPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPC
RVSVEKVTRRSIMGYGNHAGDYHKITLSHPNSVCHVATWLQDKHGCRIFEANVDATRRFV
LDNDFVTFGWYSCRRAIPRLQHRDSYAELEYDCEVGDLSVRREDSSWPSYQALAFDIECL
GEEGFPTATNEADLILQISCVLWSTGEEAGRYRRILLTLGTCEDIEGVEVYEFPSELDML
YAFFQLIRDLSVEIVTGYNVANFDWPYILDRARHIYSINPASLGKIRAGGVCEVRRPHDA
GKGFLRANTKVRITGLIPIDMYAVCRDKLSLSDYKLDTVARHLLGAKKEDVHYKEIPRLF
AAGPEGRRRLGMYCVQDSALVMDLLNHFVIHVEVAEIAKIAHIPCRRVLDDGQQIRVFSC
LLAAAQKENFILPMPSASDRDGYQGATVIQPLSGFYNSPVLVVDFASLYPSIIQAHNLCY
STMITPGEEHRLAGLRPGEDYESFRLTGGVYHFVKKHVHESFLASLLTSWLAKRKAIKKL
LAACEDPRQRTILDKQQLAIKCTCNAVYGFTGVANGLFPCLSIAETVTLQGRTMLERAKA
FVEALSPANLQALAPSPDAWAPLNPEGQLRVIYGDTDSLFIECRGFSESETLRFADALAA
HTTRSLFVAPISLEAEKTFSCLMLITKKRYVGVLTDGKTLMKGVELVRKTACKFVQTRCR
RVLDLVLADARVKEAASLLSHRPFQESFTQGLPVGFLPVIDILNQAYTDLREGRVPMGEL
CFSTELSRKLSAYKSTQMPHLAVYQKFVERNEELPQIHDRIQYVFVEPKGGVKGARKTEM
AEDPAYAERHGVPVAVDHYFDKLLQGAANILQCLFDNNSGAALSVLQNFTARPPF
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggggactcttctataaccctttcctaagacctaataaaggccttctgaaaaag
cctgacaaggagtacctgcgtctcattcccaagtgtttccagacaccaggcgccgcaggg
gtggtggatgtgcgggggcctcagccccccctgtgcttctaccaagactccctgacggtg
gtggggggtgacgaggatggaaagggcatgtggtggcgccagcgtgcccaagagggcacg
gcaaggccggaggcagacacccacggaagccctctggacttccatgtctacgacatactc
gagacggtgtacacgcacgagaaatgcgccgtcattccatcggataaacaggggtatgtg
gtgccatgtggcatcgtcatcaagctactgggccggcgcaaggccgatggggccagcgtg
tgtgtgaacgtgtttgggcagcaggcctacttctacgccagcgcgcctcagggtctggac
gtggagtttgcagtcctcagcgccctcaaggccagcaccttcgaccgcaggaccccctgc
cgggtctcggtggagaaggtcacgcgccgttccattatgggctacggcaaccatgccggc
gactaccacaagatcaccctctcccatcccaacagtgtgtgtcacgtggccacgtggctg
caagacaagcacgggtgtcggatctttgaggccaacgtggatgccacgcgccgctttgtc
ctggacaatgactttgtcacctttggctggtacagctgccgccgcgccatcccccgcctc
cagcaccgggactcgtacgccgagctcgagtacgactgtgaggtgggcgacctctcggtc
cggcgtgaagacagctcctggccctcctaccaggccctggccttcgatatcgagtgtctg
ggggaggagggcttccccacggccaccaacgaggctgacctgatcctgcagatatcctgc
gtcctctggtcgacaggggaggaggccgggcgctataggcgcatcctgctgacgctgggc
acctgcgaagacatagagggggttgaggtctacgagttcccatcggagctggacatgctc
tacgccttcttccagctcatcagagacctcagcgtggagattgtgaccggctacaacgtg
gccaactttgactggccctacattctggacagagccaggcacatctacagcatcaaccca
gcctctctgggcaaaattagggctgggggcgtctgcgaggtcaggcgaccccatgatgcg
ggcaagggcttcttgcgggccaacaccaaggtccgcatcaccggcctcatccccatcgac
atgtacgccgtgtgccgggacaagctcagcctctcagactacaagctggacacagtagcc
aggcacctactgggggccaagaaggaggatgtgcattacaaggagattcctcgcctcttt
gcagcgggccccgaggggcgcaggcggctcggcatgtactgcgtgcaggactcggccctg
gtcatggatctgctaaaccatttcgtgatccacgtggaggtggcagagattgccaagatc
gctcacatcccctgcaggcgggtgctggacgatgggcagcagatccgcgtgttctcctgc
ctcctggcggccgcccaaaaggaaaactttatcctgcccatgccctcggcctctgaccgg
gacggctaccagggggccaccgtcatccagcccctgtccggattctacaactccccggtt
ctggtggtggactttgccagcctctacccgagcatcattcaggctcataatctctgttat
tctaccatgataacgccgggagaagagcacaggctagccggcctgcgcccgggagaagac
tatgagtccttcaggctcacggggggcgtctaccactttgtaaagaagcacgtgcacgag
tccttcttggctagtctgttgacctcctggctggccaagcgcaaggccatcaagaagctg
ctggcggcctgcgaggatccgcgccaaaggaccatcctcgacaagcagcagctggccatc
aagtgcacgtgcaacgccgtctacggcttcaccggggtggccaacggcctctttccctgc
ctctccatcgccgagacggtgacgctgcagggccgcacgatgttggagcgggccaaggcc
ttcgtggaggccctgagccccgccaacctgcaggccctggccccctccccggacgcctgg
gcgcccctcaaccccgagggccagcttcgagtcatctacggggacacggactcgctgttt
atcgagtgccgggggttttcagagagcgagaccctgcgctttgccgatgccctggccgcc
cacaccacccggagcctgtttgtggcccccatctccctggaggccgagaagaccttctcc
tgcctgatgctgattacaaagaagagatatgtgggggtgctgacggacggcaagaccctg
atgaagggggtggagctcgtccggaagacggcctgcaagtttgtgcagacacgctgccgg
cgcgtgctcgacctggtgctggcggatgcccgggtaaaggaggcggccagcctcctctcc
caccggcccttccaagagtcatttacacaagggctacctgtgggctttttgcccgtcatt
gacatcctaaaccaggcctacacagacctccgtgaaggcagggtccccatgggggagctc
tgcttttcaacggagctcagccgcaagctctcagcctacaagagcacccagatgcctcac
ctggccgtctaccagaagttcgtcgagcgcaacgaggaactgccccagatccacgaccgc
atccagtacgtctttgtggagcccaaggggggagtgaagggggcgagaaagacggagatg
gccgaggacccggcctacgccgagcggcacggcgttcccgtggccgtggatcattatttc
gacaagctgctccaaggagcggccaacatcctccagtgcctctttgataacaactccggg
gccgccctctccgtcctccagaattttacagcccggccaccattctaa

DBGET integrated database retrieval system