KEGG   Virgibacillus sp. 6R: BKP57_03115Help
Entry
BKP57_03115       CDS       T04596                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vig  Virgibacillus sp. 6R
Brite
Enzymes [BR:vig01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BKP57_03115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: API90932
LinkDB All DBs
Position
complement(671232..671804)
Genome map
AA seq 190 aa AA seqDB search
MRLFLFVLLILLMVACQPEDEKTREAEMYNSSGDMVGTATFSEQADGVKVKVELEGLEPG
FHGIHVHEYAKCEGPDFTSAGNHFNPTGAEHGLMHPEGPHLGDLPNIEADASGVVNADLM
LPQVTLLDGKNSLTSGEGTSIIVTKNEDDGMSQPGGDSGERIICGTLTKEKSKGEKSPTD
PTQNNDESEK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcgactatttctattcgttctacttatcctgttgatggtagcttgccaaccggaagac
gaaaaaacaagagaggcggaaatgtacaattcatccggtgacatggttggaacagcaacc
tttagtgaacaagccgatggagtgaaggtaaaagtagaactggaagggctggaacctggg
tttcatggcatccatgtccatgagtacgctaaatgcgaaggaccagactttacatctgct
gggaatcattttaatcctacaggcgcagaacatggcctgatgcaccctgaaggtccccac
ttaggggacttgccaaatatagaagccgatgcgagtggagtagttaatgctgatctaatg
ttgccacaagttactttattggatggaaagaattcattaacttctggagaaggtacatcc
attattgttacgaaaaacgaagatgacggaatgagtcaaccaggaggcgattctggagaa
agaattatttgtggaacattgacaaaagaaaaaagtaaaggtgaaaaatcaccaacagat
ccaacgcaaaataatgacgaatcagaaaagtaa

DBGET integrated database retrieval system