KEGG   Virgibacillus sp. 6R: BKP57_05410Help
Entry
BKP57_05410       CDS       T04596                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:vig00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BKP57_05410
Enzymes [BR:vig01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BKP57_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: API91327
LinkDB All DBs
Position
complement(1203673..1205166)
Genome map
AA seq 497 aa AA seqDB search
MTTILQTDKLKNFIAGEWQEANPTVAVHNPATGEEIVHVPLSGKKEVDQAVAAAKQAQKE
WALVPAPQRAEVLYEVGNIMKERKERLSQLLTTENGKVLEEARGEVQEGIDMAFYMAGEG
RRLFGQTTPAELKDKFAMSQRCPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPAT
ETPIMAYELAKIFAEAGLPKGVLNVVFGSGASVGHSMVHHDDIRVISFTGSNNTGRDIAA
ACGSQLKKVSLEMGGKNAVIVLEDADLDLAAEGIIWSAFGTSGQRCTACSRVIVHEHVKE
QLEERLLVKLEELTIGNGLDESVKVGPIINRAGLEKIKKYVQIGKEEGATLLAGGEEWDT
NGELDGYFFTPTIFTDANATMRITQEEIFGPVVSLIPVKDFEEAIQVNNQVSYGLSSSIF
TNDVNRVFRAQRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVQALDVFTEWKA
IYVDYSGKLQRAQIDIE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgattttacaaacagataagctgaaaaattttattgctggagaatggcaggaa
gcaaatccaaccgtggctgttcataaccctgctacgggtgaggagatcgtacatgtacct
ttgtcagggaaaaaagaagttgaccaggcagtggctgcagcgaagcaagcacaaaaagaa
tgggcattggtccctgcaccacagcgggctgaggttttatatgaagtaggtaatatcatg
aaggaaagaaaggaaagactgtcgcagttattaacgacggagaatggaaaagtgttggaa
gaagcaagaggcgaagtacaggaaggcattgatatggctttttatatggcaggagaagga
cgcaggttattcgggcaaacgacgccagcagaattaaaagataaattcgcaatgagccag
cgctgtcctgtgggtgtagtgggaattattacaccgtggaatttcccaattgcgattgca
acatggaagtcatttcctgctatcgttgccggtaatgctgtcgtttggaagccggctaca
gagacgccaatcatggcttatgaattggcaaaaatatttgccgaagcaggcttaccgaaa
ggggtgcttaatgtcgtctttggcagtggcgcttccgtaggtcattccatggttcatcat
gacgatatacgcgtgatttcctttacgggatcaaacaatacaggcagagatattgcagct
gcatgtggaagccaattaaagaaagtgtctttggaaatgggcggaaaaaatgcggtgatt
gtgttggaagatgctgatttagatctagcagcagaagggattatttggagtgcttttgga
acaagcgggcaacgatgtacggcatgtagtcgggtgattgttcatgaacatgtaaaagag
cagctggaagaacgtttacttgtgaaactggaggaattaacgattggaaatggattagat
gaatctgttaaggttggtccaattattaatcgagctggattagaaaaaattaaaaagtac
gtacagattggtaaagaagagggggctacattactagctggtggcgaagaatgggataca
aatggtgaactggatggctacttctttactccaacaatttttactgatgccaatgctacg
atgcgcattacgcaggaggaaatattcggtcctgtcgtttcattaattccagtaaaggat
ttcgaggaagcgattcaagtaaataatcaagtatcatacggtctatcaagttcgattttc
acaaacgatgtgaatcgagtatttcgagcacagcgtgatttagatacagggattgtttat
gttaatgccggaacaacaggggcagaaatccatcttccgtttggagggacaaaaggaact
ggaaacggtcaccgagattcaggtgtgcaagcactagatgtattcacagaatggaaagca
atctatgttgattacagtggtaaactacagcgtgcccagatcgatatcgaataa

DBGET integrated database retrieval system