KEGG   Vulgatibacter incomptus: AKJ08_1784Help
Entry
AKJ08_1784        CDS       T04035                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
vin  Vulgatibacter incomptus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2120694..2122454
Genome map
AA seq 586 aa AA seqDB search
MKRRTSAAPSGAIPRLEPEAPSMTSCTTLVDALALASRSDAGLTFLDATEQPTPLSFRSL
RATASRIAGALSRLGVNVGDRVALVLPTAPSFPEAFFGVLLAGAVPVPLYPPLRLGRLAE
YHERTGRMLEVCGARLVLTDARIRRLLGQAVGRARPVLGCRTIDELLSSGADEAERRPEA
GDLALVQFSSGTTDRPKPVALTHANVLANLRAIADAIRDGLGPRPAGVSWLPLYHDMGLI
GCLLQAVHFPGDLTLIPPEVFLARPAIWLRAMSRTGAGISAAPDFAYGLCAKRIRDEELE
GVDLSRWRMALNGAEPIAPSVLRAFTERFSRFGFDPKALTPVYGLSEATLAVTFSRMDRP
FTTREIDGRQVVSVGSPLSGVELEIRGQKGERLAEGAVGRILVRGPSVAEGHVRDAGAED
GWLDTGDLGCLASGELFVCGRAKEVIIVRGANHSPHTIEASLGGIEGLRAGCAVAVGFAP
ERDGGEELAIVAELAKDTIPSPDLERRIRDAVFGATGLVPHTIRLVPPGTLPRTSSGKLR
RQETRRQLEAGELGPPAKVGPLLLATELLRSSLAFRLARSRPPKRR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacgcacgtccgccgcgccgagcggcgcgatcccccggctcgagcccgaggcc
ccttcgatgacgtcctgcaccaccctggtcgacgccctcgccctcgcctcgcgcagcgac
gccggcctcaccttcctcgacgcgacggagcagccgacgccgctctccttccgctccctc
cgcgccacggcgagtcggatcgcgggcgcgctctcgaggctgggcgtgaacgtcggcgat
cgggtcgccctggtgctgcccacggcgccctcgttcccggaggcgttcttcggcgtgctc
ctcgccggggcggtgccggtgccgctctacccgcccctgcgcctcggccgcctcgcggag
taccacgagcgcaccgggcgcatgctcgaggtctgcggcgcacgcctggtgctcaccgac
gcgaggatccgcaggctcctggggcaggccgtgggccgcgcccgcccggtcctcggatgc
cgaaccatcgacgagctcctgagcagcggcgccgacgaagccgagcgccgccccgaggcc
ggcgacctcgcgctcgtccagttctcctcggggaccaccgaccgcccgaagcccgtggcg
ctcacccacgcgaacgtgctcgccaacctccgcgccatcgccgacgcgatccgcgacggt
ctcggccccaggccggcgggggtctcgtggctgccgctctaccacgacatggggctcatc
ggctgcctgctccaggccgtgcacttccccggcgatctcacgctgatcccgccggaggtc
ttcctggcgaggccggcgatctggctccgcgcgatgtcccgcacgggcgccggaatctcg
gcggccccggacttcgcctacggcctctgcgcgaagcgaatccgcgacgaggagctggag
ggcgtcgacctctcgcggtggcggatggcgctgaacggcgcggagccgatcgcacccagc
gtccttcgtgcattcacggagcgcttctcgcgcttcggcttcgatcccaaggccctcacc
ccggtgtacgggctctcggaggcgaccctcgcggtcaccttctcccgaatggaccgtcca
ttcacgacgcgtgagatcgacggacgccaggtggtctccgtgggatccccgctgtccggc
gtggagctggagatccgtgggcagaaaggcgagcgcctcgcggagggagccgtggggcgc
atcctcgtccgtggcccgtcggtcgccgagggccacgtccgcgacgcgggcgccgaggac
ggatggctggacacgggcgacctcggctgcctagcgtcgggggagctcttcgtctgcggc
cgcgccaaggaggtgatcatcgtccgcggggcgaaccacagcccgcacacgatcgaggcc
agccttggcgggatcgagggcctgcgcgccggctgcgccgtggcggtcggcttcgcgccg
gagagggacggcggcgaggagctggccatcgtcgcggagctggcgaaggacacgattccg
agccccgatctcgagcgccggatccgggacgcggtcttcggcgcgacggggttggtcccg
cacaccatccgcctcgtcccccctggcaccctgccgcgcacttcgagcggcaagcttcgg
cggcaggagacccggcgccaactcgaagccggtgagctcggtccgcctgccaaggtcggt
cccctcctcctcgccaccgagctcctccgctcgtccctcgccttccgcctcgcccgatct
cggccgccgaagcgccggtag

DBGET integrated database retrieval system