KEGG   Virgibacillus sp. SK37: X953_13350Help
Entry
X953_13350        CDS       T03219                                 

Definition
(GenBank) Cu-Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vir  Virgibacillus sp. SK37
Brite
Enzymes [BR:vir01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     X953_13350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIF44014
UniProt: A0A075JQ43
LinkDB All DBs
Position
complement(2472614..2473189)
Genome map
AA seq 191 aa AA seqDB search
MRLFIIVFILLLASCQSNPDKTREVEMYNADGDLVGNAKISEKPDGVSIKLKLEGLSPGF
HGIHVHEYPSCKGPDFKSAGSHFNPEGKEHGLMHPEGSHLGDLPNIEADAGGLVDAELML
AGATLSEGKKSILTGEGTSLVVDEGKDDGVSQPAGDTGPRIICGEIKTNPDSKDNSGSPT
DPTQLNEKQEE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagactttttatcatagtatttattttactcttggcctcctgtcaaagtaatccagac
aaaacaagagaagtcgaaatgtataatgctgatggcgacttagtcggtaatgcaaagata
agcgaaaaaccggatggagtaagtattaaattaaagttagagggtttatcccctggattt
catggtatccatgtacatgaatatccttcttgcaaggggcctgattttaagagtgctggc
agtcactttaatcccgagggaaaagagcatggtttaatgcatcccgaaggatctcattta
ggtgatttaccaaatattgaggcggacgcaggaggactggttgatgctgaattgatgcta
gctggcgctactttatctgaaggaaagaaatcgattttaaccggggaaggaacttcgctt
gttgtagacgaaggtaaagatgatggagtaagtcaacctgcgggtgatacaggtcccagg
ataatctgtggggaaattaaaacaaatccggactccaaagataactcaggatcaccaaca
gatcccactcaacttaatgagaagcaagaagagtaa

DBGET integrated database retrieval system