KEGG   Vibrio natriegens: PN96_15405Help
Entry
PN96_15405        CDS       T04636                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vna  Vibrio natriegens
Brite
Enzymes [BR:vna01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PN96_15405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:98608..99081
Genome map
AA seq 157 aa AA seqDB search
MIAPAAIAQSITMTDLNTNKSVGTVELSESQYGVVFSPQLTSIPAGLHGFHVHVNPSCES
AEKDGKTVLGGAAGGHYDPQNTGKHGYPWTDDNHLGDLPPLYADMEGNAVSPVVAPRLKL
SDLKGRALMIHAGGDNHSDQPAKLGGGGARIVCGVIE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacctgccgctattgctcaatcgatcaccatgactgatctcaataccaacaaa
agcgttggtacggttgagctatcagaaagtcaatacggcgttgtattttcgcctcaattg
accagtatccctgcagggctgcatggctttcacgtgcatgtaaacccatcttgtgaaagt
gcagaaaaagacggaaaaaccgttttaggcggtgcagctggcggccattatgatccacaa
aataccggaaaacatgggtatccgtggacagacgataaccaccttggcgaccttcctccc
ttgtatgcggatatggaagggaatgccgtttcacccgtcgttgcaccacgcctaaagctg
tccgatttgaaaggccgagccctgatgatacatgcaggtggagataaccattccgatcaa
ccggcgaaactcggtggtggtggggcccgcattgtttgtggagtaattgagtaa

DBGET integrated database retrieval system