KEGG   Vibrio natriegens: PN96_21090Help
Entry
PN96_21090        CDS       T04636                                 

Definition
(GenBank) acyl-phosphate glycerol 3-phosphate acyltransferase
Organism
vna  Vibrio natriegens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:1403809..1406637
Genome map
AA seq 942 aa AA seqDB search
MSDQNDTTSRDSENIAQTVLEIVRDLKLELDPEGLSSVSIHLKSDLDHDLCLDSLTRAEL
ITRIESRFDVSLPDHALSSISTPEDIIGEILTAGSSNKTAYLDESAKAIKLDSVHQLPTE
VKTLQALLDWHVEHHPKRPHLYVYQNADEVVEVSYKQLKQQALKISAGLIDAGIEAGDCV
AIMLPTCTDYFFSFFAILYARAVPVPIYPPARIEHVEDHLNRHASILNNAQAKLLITVPE
AKPVAHLLKLQVPSVDAVVTASDLQKDTSFPDMGEAKTDDIAFLQYTSGSTGVPKGVTLT
HANLLANIRAMGKVINAKSDDVFVSWLPVYHDMGLIGAWLGSLYHAIPLVIMSPLLFLTK
PQRWLWAIHHHRGTLSPAPNFAYELCVSRVKESDLEGLDLSSWRLSWNGAEPVSPQSIQN
FSEKYAKYGFKPETMSPVYGLAESSVGLTFPVTVREPRIEYFQRASLSQFGRAVLAQQED
EDTIPFIGLGYPLPEHQIRIVDDLGKELPDGEEGALEFQGPSATQGYYRNPEKTKALYHD
GWLVTGDRAFTLGGELFITGRSKDIIIKAGRNIYPHELEQAVGSIDGIRKGCVAAFGSHD
AHSGTEKLIVLAESRETSKDKVKQLKRKINKLSLKLLGNPVDDVIIGPPHSIPKTSSGKI
RRSACKDLHERGSFAKQHRALWLQTLNLALAGIMPQLRKYMRILLDIGYAAYSWLVLGIL
APIVWLLVAVLPNKAMCWKIAQFGAKALMGLTGTKCTIEGKEHLPAGNAPCIFVANHCSY
LDGLVIVAVSGLPCRFVAKSELLNNPFTRIFLSKLGTEFVERFDVEKSVVDAKRLAFEAE
DCQPMVVFPEGTLYRMSGLHPFHMGAFIAAASSQVPVIPITLRGTRSKLRGNSLFPRRGD
ISVSIGEPVFPNGNDWNAALELRDKARSEILTHCGEPDMARS
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaaaatgacactacaagtagagactctgaaaacatcgcgcaaactgtgtta
gagatcgttcgggacctaaaacttgaactagaccccgaaggtctctcgtccgtttctatt
cacttaaaaagtgacctcgaccatgacctttgtttggatagcctaacgcgtgctgagcta
atcacacgcatagaaagtcgtttcgacgtgtcacttccggatcacgcattgtccagcata
tcgacaccagaagatattatcggcgagattttaacggcaggatcatcaaataaaacagcc
tacttagatgagtcggcgaaagcgatcaaactcgactcagtccatcagttaccaactgag
gtcaaaacgctacaagcgctactcgactggcatgtggaacatcacccgaaacgcccccat
ctttacgtttatcaaaacgctgatgaagtggtagaagtcagctataaacaactaaaacaa
caagcactcaaaatctccgctgggctaattgatgcaggaattgaagctggggactgcgtc
gcaatcatgttgccaacctgtactgactacttcttcagcttttttgcgatactttatgcc
agagcggtgcctgttcccatttatccaccagcccgaattgaacatgtcgaagatcatttg
aatcgtcacgccagtattctcaacaatgctcaggcaaagctattgattacggtgccagaa
gcaaaacctgtcgcccacttacttaaattacaagtaccgtctgttgatgccgtcgttacc
gcgagtgatttgcaaaaagacaccagcttccccgatatgggtgaagctaaaaccgacgat
attgcttttttgcaatacacatccggaagtacgggtgtacctaagggcgtgacccttacc
catgcgaacttactcgctaatatccgcgcgatgggtaaagtcattaacgccaagtcggac
gatgtgtttgtgagttggctacccgtctaccacgatatgggactcatcggagcatggctt
ggtagcttgtatcatgcgatccctctggtgatcatgtcgccattgctcttcttaactaaa
cctcagcgatggctatgggcgattcatcatcatcgaggcaccctttctcccgcaccaaac
ttcgcctatgagctttgtgtttctcgagtgaaggaaagcgatctcgaagggctcgattta
agcagttggcggctttcctggaacggcgcagagcccgtgagtccacaatcgatccaaaac
ttctctgaaaaatacgccaagtatggatttaagccagaaaccatgtcgcccgtttatggg
ctagcggaatcgtcggtcgggctgacattcccagtgaccgtccgcgaaccgcgtattgag
tatttccaaagagcatcgttaagccagtttggtcgtgctgtactcgcccaacaggaagat
gaagataccattccgtttattggcttaggctacccacttcccgagcatcaaattcgtatc
gttgatgatctgggcaaagaattacccgatggagaagaaggcgcacttgagtttcagggc
ccgtccgccacccagggttactatcgaaacccagaaaaaaccaaagcgctgtatcatgat
ggttggctggtaacaggggaccgcgcgtttacattaggcggcgagctttttatcaccgga
cgtagcaaagatatcattatcaaagctgggcgtaatatctatcctcatgagctggaacaa
gcggtagggagtattgatggtattcgcaaaggttgtgtggccgcgtttggtagccacgac
gcgcactccggtacggagaaactgatcgtgttggcggaaagccgagaaaccagtaaagac
aaagtaaaacagctaaaacgtaaaattaacaaactctctctaaaactacttggcaatccc
gtcgatgatgtcattatcggcccgcctcactccataccaaaaacgtccagtgggaaaatt
cgtcgcagtgcgtgtaaagatctgcatgagcgtggatcctttgcgaaacaacatcgggct
ttgtggttacaaaccctgaatctcgccttagctggcatcatgccgcaactgcgtaaatac
atgcgaatccttttagacatcgggtacgcggcctattcgtggttagtgttgggaatactt
gctcctatcgtctggttacttgttgccgtcttacccaataaggccatgtgctggaaaata
gcccagtttggtgccaaagcgctcatgggacttactggcacaaagtgcaccatcgaagga
aaggaacacttaccagcaggaaatgccccctgtatttttgtcgcgaatcattgcagttat
ctagatgggctggtgattgttgccgtttcaggattgccttgccgttttgtggcaaaaagt
gagttactcaataatccatttaccagaattttcttaagcaaactcggcacggagtttgtt
gaacggtttgatgtggaaaaaagcgtggtggatgccaaaaggctagcgtttgaagctgaa
gactgtcagccaatggtcgtatttcctgaagggacattatatcgaatgtctggccttcat
ccgtttcatatgggcgcctttattgctgccgcaagctcacaagtgccagtcatcccgatt
accttacgtggtacgcgctctaaactcagaggtaactctcttttcccacgtagaggcgac
atcagtgtaagcattggtgaaccagtcttccccaatggtaatgactggaacgcagcgctt
gaacttcgcgataaagcccgatcagagatcctcacccactgtggtgagccagatatggca
cgcagttag

DBGET integrated database retrieval system