KEGG   Virgibacillus necropolis: CFK40_03050Help
Entry
CFK40_03050       CDS       T04976                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
vne  Virgibacillus necropolis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CFK40_03050
Enzymes [BR:vne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CFK40_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
615206..615826
Genome map
AA seq 206 aa AA seqDB search
MYVMKQSGWVEVICGSMFSGKSEELIRRVRRATYANLSVRVFKPALDSRYAKDSVVSHNG
TSTIARPVNNSQEILDHIDSNVDIIGIDEVQFFDESVVEVADELANKGIRVIIAGLDTDF
RGEPFGPMPKLMALSESVTKLNAICPVCGSPASRTQRLINGKPASYDDPVILVGASESYE
PRCRHHHKVPGKPSNPILKTLSKLAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtaatgaaacaaagtggttgggtagaagtgatttgcggtagtatgttttcaggc
aaatcagaggaattaattcgacgcgtccgccgcgcaacgtacgctaacttatctgtacgt
gtttttaaacctgcgttagacagtcgatatgcaaaggattcagttgtttcccacaatgga
acttccaccattgcaagacctgtaaataattcacaagaaattcttgatcatatagatagt
aacgtggacatcattggaattgatgaggttcaattttttgatgaaagtgttgttgaggta
gcggacgagcttgcaaataaaggtattcgcgtgatcattgctggtcttgatactgatttt
cgcggggaaccgtttggaccaatgccgaagttgatggcgctaagtgaatcggttacaaag
ttaaacgccatttgccctgtttgtggatcaccagcaagccggacgcagcgcttaattaat
gggaaaccagcttcatatgatgatccagttatattggtcggtgcttcagaatcatatgaa
ccgagatgtcgtcatcaccacaaggtcccaggtaaacccagtaaccccattttaaaaaca
ctatcaaaattagctaagtaa

DBGET integrated database retrieval system