KEGG   Virgibacillus necropolis: CFK40_15175Help
Entry
CFK40_15175       CDS       T04976                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
vne  Virgibacillus necropolis
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:vne00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFK40_15175
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CFK40_15175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3207221..3208684)
Genome map
AA seq 487 aa AA seqDB search
MSVTVNNKTSLNFLNGRWIPSVTGEIQESRNPANSNEIVGTVQRSSEVDLDNSVKAAKEA
LTAWKKLSGPERGQYLFKVANILEQRLDEIGECMTKEMGKTFPEAKGETKRAVDILRYFA
GEGMRKKGDVIPSTDNQALMYTTRVPLGVVGVITPWNFPAAIPIWKIAPALIYGNTVVIK
PATEAAVTMSKIIACFDEAGLPPGVINMVTGPGSKVGQAMIDHPDVNALTFTGSNQTGKK
VAQGALDRGAKYQLEMGGKNPVIVLDDADLDLAVEQTINGGLRSTGQKCTATSRIIVQSG
IYEQFKNKLLEKIKRIKIGDGMTNEVWMGPCASENQLNTVMSYIHKGSEEGATLIAGGKR
LQDNEFADGYYVEPTVFENVTSDMTIAQEEIFGPVLALMKAETIKEALDLANDVKFGLSA
SIFTRNIANMLTFIDDMEAGLVRVNAESAGVELQAPFGGMKQSSSHSREQGQAAIEFFTS
IKTVFVK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgacagtgaataacaaaacaagtctgaattttcttaatggaaggtggattcca
tcggtaacgggtgagattcaggaaagtcgtaatcctgccaattctaatgaaattgtagga
actgttcaacgatcatcagaagtggatctggacaattcagttaaggcggcaaaagaggca
ttaactgcctggaagaaactttctggacctgaacgtggacagtatctctttaaagtagca
aacattttagaacaacgattggatgaaatcggtgaatgtatgacaaaagagatgggaaaa
accttcccagaagccaagggtgaaaccaaacgggctgtggatatcttgcggtattttgct
ggagaggggatgcgtaaaaagggtgatgttatcccgtctactgataatcaagctttgatg
tataccactcgtgtacccttaggtgttgttggtgtcataactccttggaattttccagca
gcaatccctatttggaaaatagccccggcgctgatttatggaaacactgtggtaattaag
cctgctaccgaagcagcagttacgatgtcaaaaattatcgcatgttttgatgaggctgga
ttaccaccgggtgttattaacatggttacgggacctggatctaaggtaggtcaagcaatg
attgaccaccctgatgttaatgcgcttacttttactgggtctaatcaaactggaaaaaaa
gttgcacagggagctttggaccgcggagctaaataccagttggaaatgggaggtaaaaac
cccgttattgttttagatgatgcagatcttgatttagcagtggagcaaacgataaacggg
ggcctccgctcaaccggacaaaagtgcaccgcaacaagtaggataatcgttcagagtgga
atatatgaacagtttaagaacaagcttttagaaaaaataaagcgtattaaaattggtgac
ggaatgacaaatgaagtttggatgggaccatgtgctagtgaaaatcaattaaacacggtc
atgtcatatattcacaaagggtctgaagagggagccacacttattgcagggggaaaaaga
ctccaggataacgagtttgcagatggttattatgttgaaccaacagtttttgagaatgtt
acatccgatatgacgatcgcacaagaggaaatttttggccctgtacttgctttaatgaaa
gctgaaacaattaaggaagctttggaccttgctaacgatgttaaatttggactaagtgca
tccattttcactagaaacatcgcaaatatgctaacgtttatcgacgatatggaagcaggt
ctagttcgagttaatgctgaaagtgctggtgtggaattacaggctccctttggcgggatg
aaacaatcaagttcccattccagagaacaagggcaggcagcaattgaatttttcacctcg
ataaaaacagtctttgtaaaataa

DBGET integrated database retrieval system