KEGG   Vibrio nigripulchritudo: VIBNI_A3334Help
Entry
VIBNI_A3334       CDS       T02871                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu 2
  KO
K02358  
elongation factor Tu
Organism
vni  Vibrio nigripulchritudo
Brite
Translation factors [BR:vni03012]
 Eukaryotic Type
  Elongation factors
   VIBNI_A3334 (tufB)
 Prokaryotic Type
   VIBNI_A3334 (tufB)
Mitochondrial biogenesis [BR:vni03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VIBNI_A3334 (tufB)
Exosome [BR:vni04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VIBNI_A3334 (tufB)
  Exosomal proteins of breast cancer cells
   VIBNI_A3334 (tufB)
  Exosomal proteins of colorectal cancer cells
   VIBNI_A3334 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3508186..3509370)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGEAKDFASIDNAPEERERG
ITIATSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYEFPGDDLPVIQGSALGALN
GEKQWEDKIVELAEALDSYIPEPERAVDQPFLLPIEDVFSIQGRGTVVTGRIERGILTVG
DDVEIVGIKETTTTTCTGVEMFRKLLDEGRAGENVGALLRGTKRDEVERGQVLAAPGSIN
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDIQLPEGVEMVMPGDNVQMT
VTLIAPIAMDEGLRFAIREGGRTVGAGVVAKIFD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacgaaaccgcacgtaaacgttggtactatcggccac
gttgaccacggtaaaacaactctaactgctgcaatctgtactactctagctaaagtgtac
ggcggtgaagcgaaagacttcgcatctatcgataacgctccagaagagcgtgagcgtggt
atcacaatcgcaacgtctcacgttgagtacgacactccatcacgtcactacgcacacgta
gactgcccaggacacgctgactatgttaaaaacatgattacaggtgctgcgcaaatggac
ggtggtatcctagttgtagctgcgactgatggcccaatgcctcaaactcgtgagcacatc
ctactaggccgtcaggttggtatcccatacatcatcgtattcatgaacaagtgtgacatg
gttgatgatgaagagcttctagagctagtggaaatggaagttcgtgaacttctttctgag
tacgaattcccaggtgatgacctaccagtaatccaaggttcagctcttggcgctctaaac
ggcgaaaagcagtgggaagacaagattgttgagcttgcagaagcactagactcttacatc
ccagagccagagcgtgctgtagaccagccgttcctactaccgattgaagacgtattctca
atccagggtcgtggtacagtagtaactggtcgtatcgagcgtggtatcctaacagtaggt
gacgacgtagagatcgtaggtatcaaagaaacgacaactactacatgtactggtgtagag
atgttccgtaagcttctagacgaaggtcgtgcgggtgagaacgttggtgcactactacgt
ggtactaagcgtgatgaagtagagcgtggtcaagtactggctgcacctggttcaatcaac
ccacacactaagttcgaatcagaagtatacgtactgtctaaagatgaaggtggtcgtcac
actccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaactggt
gacatccagcttccagaaggcgttgaaatggtaatgcctggcgacaacgtacaaatgact
gttactctaatcgctccaatcgcgatggacgaaggtctacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgctggtgttgttgcgaaaatctttgattaa

DBGET integrated database retrieval system