KEGG   Vibrio owensii: A9237_21000Help
Entry
A9237_21000       CDS       T04844                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vow  Vibrio owensii
Pathway
vow00473  D-Alanine metabolism
vow00550  Peptidoglycan biosynthesis
vow01100  Metabolic pathways
vow01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vow00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9237_21000
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A9237_21000
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A9237_21000
Enzymes [BR:vow01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A9237_21000
Peptidoglycan biosynthesis and degradation proteins [BR:vow01011]
 Precursor biosynthesis
  Amino acid ligase
   A9237_21000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: AQW60505
LinkDB All DBs
Position
2:992590..993579
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIENVSVTRVEIKNEGWVTNQGELVYLDL
NTKKLCSDNLNLDIDFIVPCIHGFPGETGDIQSMFEIAGIPYLGCGPEASSNSFNKITSK
LWYDAIGIPNTPYLFLTRNDEQAHEQASQAFDKWGKVFVKAARQGSSVGCYSVTEKEALS
QAVNDAFGFSEQVLVEKSVKPRELEVAAYEMNGQLFITKPGEVIAPDGAFYSYDEKYSSS
SHSLTEVEAKNLTEEQVEAIRVASETVFKQMNLRHLSRIDFFLTEDDEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLADCIHTAI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaatatccttttactatgcggtggcggctcatctgagcacgagatttcactg
ctttctgcaaactttgtagagcaacagttaaatctgatcgaaaacgtaagcgtgacgcgc
gtagaaatcaaaaatgaaggttgggtgacaaaccaaggtgaactggtttatttggacctt
aataccaaaaagctttgctcagacaaccttaacctagatatcgatttcattgtcccttgt
atccacggtttcccgggtgaaactggtgatatccaatctatgtttgaaatcgcgggtatt
ccttacctaggttgtgggcctgaagcgagcagcaacagcttcaataagatcacatcaaag
ctttggtacgatgcgattggtatcccaaacacaccataccttttcttaacgcgtaatgat
gaacaagcccatgaacaagcgtcacaagcgtttgataagtggggtaaagtgtttgtcaaa
gcggctcgtcaaggttcttcagttggctgttacagtgtcactgaaaaggaagctttatcg
caagccgttaacgatgcatttggtttctcagagcaagtattggtagaaaaatcagtcaaa
cctcgtgaactggaagtcgcagcttatgagatgaatggccagttattcattaccaaacct
ggtgaagtgattgcgcctgatggtgctttttactcttacgatgagaagtacagcagctcg
agccattcattgactgaagtcgaagcgaaaaacctaacggaagaacaggtagaagcgatt
cgtgtggcttcagaaactgtgtttaagcaaatgaacttacgtcatttatcgcgcatcgac
ttctttttaacagaagatgatgaaatctacctaaacgaagtaaacacgttccctggtatg
acgccgatttcgatgttccctaaaatgctgcaaaacaacggtcacaaattccacgaattc
ctagcagattgtattcatactgcaatctaa

DBGET integrated database retrieval system