KEGG   Vibrio owensii: A9237_21540Help
Entry
A9237_21540       CDS       T04844                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vow  Vibrio owensii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vow00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9237_21540
Enzymes [BR:vow01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A9237_21540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(1091488..1093011)
Genome map
AA seq 507 aa AA seqDB search
MKTFNLKPTLLPLTLLLSSPVMAAQNGTMMQYFHWYVPNDGALWTQVENNAPALSDNGFT
ALWLPPAYKGAGGSNDVGYGVYDMYDLGEFDQKGSVRTKYGTKDQYLDAIKAAHANNIQI
YGDVVFNHRGGADGKSWVDTKRVDWNNRNIELGDKWIEAWVEFSFPGRNDKYSDFHWTWY
HFDGVDWDDAGKEKAIFKFKGDGKAWDWEVSSEKGNYDYLMYADLDMDHPEVKQELKDWG
EWYLNMTSVDGFRMDAVKHIKYQYLQEWIDYLRWKTGKELFTVGEYWNYDVNNLHNFITK
TSGSMSLFDAPLHMNFYNASRSGGNFDMRRIMDGTLMKDNPVKAVTLVENHDTQPLQALE
SPVDWWFKPLAYAFILLREEGYPSVFYADYYGAQYSDKGHDINMVKVPYIEQLVKARKDY
AYGKQHSYLDHWDVIGWTREGDAEHPNSMAVIMSDGPGGTKWMYTGSPSTRYVDKLGIRT
EEVWTDANGWAEFPVNGGSVSVWVGVK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcaaccttaaacccacacttttacctttaactttgctgctcagttcgccg
gtaatggcggctcaaaatggaaccatgatgcagtatttccattggtatgtgccaaatgac
ggcgcactctggacacaagttgaaaacaacgcgccagcactatcggacaacggctttacc
gcgttatggctaccgcctgcctataaaggcgctggtggcagcaacgacgtcggttatggc
gtttacgatatgtatgacttgggggagtttgatcaaaaaggatcggtgcgaaccaaatac
ggtactaaagaccaatacctcgatgccatcaaagcggcacacgcaaataacattcaaatt
tatggtgatgtagtgtttaaccaccgtggcggtgcggatggtaaatcgtgggtcgacacc
aagcgagtcgattggaacaaccgaaatattgagctcggcgacaaatggattgaagcttgg
gtcgaatttagcttcccggggcgtaatgacaaatactcagatttccactggacgtggtat
cactttgatggggtcgactgggatgacgcaggtaaagagaaagcgatcttcaaattcaaa
ggtgacggcaaagcatgggattgggaagtcagttctgaaaaaggcaactacgactacctc
atgtacgcagatttagacatggaccacccagaagtgaagcaagagctgaaagactggggc
gagtggtacctaaacatgacgagtgtggatggtttccgaatggacgcggttaaacacatc
aaataccagtacctacaagagtggatcgattacttgcgttggaagacaggcaaagagctg
tttactgtgggtgagtactggaactacgacgtgaacaatctgcataactttatcactaag
acttctggcagcatgtcattgtttgatgcaccgctacacatgaacttctataacgcttcg
cgctcgggtggaaacttcgatatgcgccgtatcatggatggcaccttgatgaaggacaac
ccagtgaaagcggtaacactggtcgagaaccatgatacgcaaccattgcaagcgctggag
tctccggttgattggtggttcaagcctcttgcgtacgcgttcattttgcttcgtgaagaa
ggttatccgtcagtgttctacgcggattactacggcgcacaatacagcgataaaggacac
gacatcaatatggtgaaagtgccttacattgagcagttggtgaaagcccgtaaagattat
gcttatggcaagcagcactcgtaccttgatcattgggatgtgattggttggacacgagag
ggggatgcggaacacccgaactcaatggcggttatcatgagtgatggccctggcggtaca
aaatggatgtacacaggttcaccaagtacgcgttacgtcgataagttaggtattcgcacc
gaagaagtctggactgacgccaacggttgggcagagttcccagtgaacggtggttcggtt
tctgtttgggtcggcgttaaataa

DBGET integrated database retrieval system