KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0461Help
Entry
VPA0461           CDS       T00120                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VPA0461
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VPA0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:456193..457542
Genome map
AA seq 449 aa AA seqDB search
MSGLQETQSAGANVILHAFDWKYADIAQRANEIHELGYGSVLVSPPMKSAHDERWWQRYQ
PQDYRVIDNALGDTQDFIYMVRELERVGVLVYADVVFNHMANEAHLRRDLQYPRQDVLDQ
YRQNEHKYQSLKLFGDLSKPLFSEEDFVEAFGIKDWKDKWQVQNGRITGGPTDPGLPTLR
VCEHVVEQQRAYLKALKAIGVKGFRIDAAKHMTLEHLKRVWTDDITQDVHIFGEIITDGG
ATEEEYQLFLEPYLQETRLGAYDFPLFSTIFKAFSKKGSFKSLIDPYCFGQALSNGRAIT
FVVTHDIPNNDVFLDLIMDEEDEWIAYAYILGRDGGVPLVYTDLDTSGIKNKNGKPRWKD
AWNDPRMAKMIAFHNVTHGESMTVLEGNDDMLVLKRGEKGIVVLNKSTRAQSLSLKTECD
WFDLMSDQSVKAGIELKVPAKSFMLLVQK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttacaggaaacgcaatcagcaggtgcaaacgtgattttgcacgcctttgat
tggaagtacgctgacattgcccaacgagcaaatgaaatccacgagctaggttatggctcg
gtgttggtttcgccaccaatgaaaagcgcccacgatgaacgttggtggcagcgctatcaa
ccacaagattaccgtgttatcgacaacgcgctcggtgacacccaagacttcatctatatg
gttcgcgagctcgaacgcgtaggcgttttggtgtacgccgatgtggtgtttaaccacatg
gctaacgaagcacatttacgccgtgatctgcaatatcctcgtcaggatgtgttagatcaa
taccgacaaaacgaacataaataccagtctttaaagcttttcggcgatttatccaaaccg
ctatttagcgaagaagattttgttgaagcgtttggtatcaaagactggaaagataaatgg
caggtccaaaatggccgaattacaggtgggccaaccgatcctggtttaccaacccttcgc
gtttgtgaacatgttgtcgagcagcagcgagcttacttaaaagcattgaaagcgataggt
gtgaaaggcttccgtattgatgccgcgaagcacatgacgcttgaacacttaaaacgcgta
tggacagacgacataacccaagacgtgcatatttttggggaaatcattaccgatggcggt
gcaacagaagaagagtatcaactgtttcttgagccgtatttacaagaaacccgtttaggt
gcgtatgatttcccgctgttttcgaccatctttaaagcattttcaaaaaaaggcagtttc
aagtctctgattgacccttactgttttggccaagcgctttcaaacggtcgagccattact
tttgtggtgacgcatgatattcccaacaacgacgtctttctcgacttgataatggatgaa
gaggatgagtggatcgcttatgcctacattcttggtcgcgatggcggcgtgcctttggtt
tataccgatctggataccagcggcattaagaacaaaaacggaaagccaagatggaaagac
gcttggaatgatcctcgtatggcgaagatgatcgcgttccacaatgtgactcatggcgaa
tcaatgacggtactggaagggaatgacgatatgctagtgctaaaacgcggagagaaaggc
attgtagtgctaaacaaatccacgcgcgcacaatcgctatcgctaaagacagagtgtgat
tggttcgatttgatgtcagatcaaagcgttaaagccgggatagaactgaaggttccggca
aagtcgttcatgttattggtgcaaaaataa

DBGET integrated database retrieval system