KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0909Help
Entry
VPBB_A0909        CDS       T02409                                 

Definition
(GenBank) Cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VPBB_A0909
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VPBB_A0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(1019688..1021211)
Genome map
AA seq 507 aa AA seqDB search
MKTFKLKRTFLPLTLLLSAPAFAGQNGTMMQYFHWYVPNDGALWTQVESNAPALAENGFT
ALWLPPAYKGAGGSNDVGYGVYDMYDLGEFDQKGSVRTKYGTKAQYISAINAAHNNNIQI
YGDVVFNHRGGADGKSWVDTKRVDWDNRNIELGDKWIEAWVEFNFPGRNDKYSNFHWTWY
HFDGVDWDDAGKEKAIFKFKGEGKAWDWEVSSEKGNYDYLMYADLDMDHPEVKQELKDWG
EWYINMTGVDGFRMDAVKHIKYQYLQEWIDHLRWKTGKELFTVGEYWNYDVNQLHNFITK
TSGSMSLFDAPLHMNFYNASKSGGNYDMRQIMNGTLMKDNPVKAVTLVENHDTQPLQALE
STVDWWFKPLAYAFILLREEGYPSVFYADYYGAQYSDKGYNINMAKVPYIEEFVTLRKEY
AYGKQNSYLDHWDVIGWTREGDAEHPNSMAVIMSDGPGGTKWMYTGKPSTRYVDKLGIRT
EDVWTDANGWAEFPVNGGSVSVWVGVK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcaaattaaaacgcacttttttaccgctaaccttgctgctcagtgctcct
gcctttgctgggcaaaatggcaccatgatgcagtattttcattggtatgtacctaatgat
ggcgcattatggacgcaggttgaaagcaatgctccagcactcgctgaaaacggttttaca
gcgctctggctaccgccagcttacaaaggcgcgggcggcagtaatgacgtcggttatggc
gtctatgatatgtacgatttaggtgagtttgaccaaaaaggctcagtacgaaccaaatac
ggcaccaaggctcagtacatctctgcaatcaatgccgcgcacaacaacaatatccaaatt
tacggcgacgttgtgtttaaccaccgaggtggcgcagatgggaagtcgtgggtcgatacc
aagcgcgttgattgggacaaccgcaacattgagctgggcgacaaatggattgaagcttgg
gttgagtttaattttcctggccgcaacgacaaatactcgaacttccattggacttggtat
cactttgacggtgttgactgggatgacgccggcaaagaaaaagcgatctttaaattcaaa
ggcgaaggaaaagcatgggattgggaagtcagctctgaaaaaggcaattacgactaccta
atgtacgccgatttagacatggatcacccagaagttaaacaagagctgaaagattggggt
gagtggtacatcaacatgaccggcgttgatggctttagaatggatgccgtgaagcacatt
aaatatcagtatctacaagagtggattgatcatttacgttggaaaacaggcaaagagctt
ttcaccgttggtgagtattggaattacgacgtaaatcaactgcacaactttattactaag
acctctggcagtatgtcgttgttcgatgcgccgcttcacatgaacttctacaacgcgtca
aaatctggcggcaattacgatatgcgccaaatcatgaatggcacgttgatgaaggacaac
ccagtcaaagcagtgactctcgtagaaaaccacgatacgcagccactgcaggcgttagag
tcgacagtagattggtggttcaagcctcttgcttacgcattcattttattgcgtgaagaa
ggttatccatcggtgttctacgcagattactacggcgcgcagtacagcgacaaaggctac
aacattaatatggccaaagtgccttacattgaagaatttgtaacactgcgtaaagagtat
gcgtatggcaaacagaattcttatctcgaccattgggatgtgattggctggactcgagag
ggcgatgctgaacatccaaactcaatggcggtgatcatgagtgatggaccgggcggaaca
aaatggatgtataccggtaagccaagcacgcgctatgtcgacaagctgggtatccgaact
gaagatgtttggaccgatgccaatggctgggcagaatttcctgtcaatggtggttcagtc
tcggtttgggtgggcgttaagtaa

DBGET integrated database retrieval system