KEGG   Variovorax paradoxus B4: VAPA_1c17500Help
Entry
VAPA_1c17500      CDS       T02835                                 

Definition
(GenBank) putative DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    VAPA_1c17500
Enzymes [BR:vpd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VAPA_1c17500
DNA repair and recombination proteins [BR:vpd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     VAPA_1c17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGU48858
UniProt: T1X8H8
LinkDB All DBs
Position
1:1885494..1888049
Genome map
AA seq 851 aa AA seqDB search
MARANPLKRYKEKRNFGVTPEPEEGGASAPGVLQFVVQKHWATRLHYDFRIELDGAMKSW
AVPKGPSYDTHDKRMAVHVEDHPISYNRFEGEIPPRQYGAGKVMIWDKGTWTPIGDPRKG
YKAGHLKFELHGYKLRGKWALVRMHGNAKDKQDAWLLIKEHDAYARAATEFSVVDQFPDS
VAEMPMPAAAVSAHGAAAPVPARKRGKSTAGGMPADAVKAAMPAKLSPLLATLVDGPPPD
PENWFYEIKFDGYRLLARVDAKGGVQLLTRNGHDWSGRMPHLVRAIERMKLKPGWLDGEI
VVLNESGGTDFQALQNAFDSEKTRNIVYFLFDLPYYGGFDLTGVPLVERRGLLQALLAKA
PPEIRFSEIFDAPPEDIIASACKIGLEGVIGKRKNSTYASRRSPDWIKLKCSQRQEFVIG
GYTDPKGSRVGIGALLIGVHDDRGDLVYAGAVGAGFNGRALADMLERLKPLGVDKRPFKN
PTENDRRAHWVKPVLLAEVTFSDWTKDGHVRHPVFHAVRSDKPAKAIVREKPVHQAGADR
EPEPEPAATMPANFKVSHADRVVDPSTGITKVEVVRFYGLVAPLMMAHLKGRPVSFVRAP
QGINGPLFFQKHLELGQMAGVRQLDAALWPDHPELIEVAGPLGLLSAAQMNVIEFHTWNG
VKTLIGKPDRMTFDLDPGEGVGWPTVLQAAELMRVVLDELGLAPFCKTSGGKGLHVVVPL
KRQYDWDTIKDFSQAIVRHMARTLPQMFVAKSGPGNRVGRIFIDYLRNGFGATTICAWSV
RARPGMGVSVPVEWQEVPTLTSGAQWTLRNIHARLDRGNDPWAGYAKAAKSPGAAMKMLG
FEAASARARKR
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcaaacccgctgaagcgctacaaggaaaagcgcaacttcggcgtcacgccc
gagcctgaggagggcggcgcctcggcgcccggcgtgctgcagtttgtggtgcagaagcac
tgggcgacccggctgcactacgacttccgcatcgagctcgacggcgcgatgaagagctgg
gccgtacccaagggcccgagctacgacacgcacgacaagcgcatggccgtgcatgtggag
gaccacccgatctcctacaaccggttcgagggcgagataccgccccggcagtacggcgct
ggcaaggtgatgatctgggacaagggcacctggacgcccatcggcgatccgcgcaagggc
tacaaggcggggcatctcaagttcgaactgcacggctacaagctgcgcggcaagtgggcc
ctggtgcgcatgcacggcaacgccaaggacaagcaggacgcgtggctgctgatcaaggag
cacgatgcgtacgcccgtgcagccacggagttcagcgtggtcgaccagttcccggacagc
gtggcggagatgccgatgcccgctgcggccgtttcggcgcatggcgcggcagcacccgtg
ccggcaagaaaacgcggcaagtcgaccgccggcggcatgcccgccgatgcggtgaaggcg
gccatgcccgccaagctctcgccattgctcgccacgctggtcgacggcccgccgcccgat
cccgagaactggttctacgagatcaagttcgacggctaccggctgctcgcccgcgtcgat
gcgaaaggcggcgtgcagctgctcacgcgcaacggccacgactggagcggccgcatgccg
cacctggtgcgcgcgatcgagcgcatgaagctgaagccgggctggctcgatggcgagatc
gtggtgctcaacgagtccggcggcacggacttccaggccttgcagaacgccttcgacagc
gagaagacgcgcaacatcgtctacttcctgttcgacctgccgtactacggcggcttcgat
ctcactggcgtgccgctggtggagcgccgcggcctgctgcaggcgctgcttgccaaggcg
ccgcccgaaatccgtttcagcgagatcttcgatgcaccgccggaagacatcattgcctcg
gcctgcaagatcgggctcgaaggcgtgatcggaaagcgaaagaacagcacctatgcctcg
cgccgctcgcccgactggatcaagctcaagtgctcgcagcggcaggagttcgtcatcggc
ggctataccgatcccaagggctcgcgggtgggcatcggcgccctgctgatcggcgtgcac
gacgacaggggcgacctcgtctacgccggagcggtgggcgcgggcttcaacggccgagcg
cttgccgacatgctcgaaaggctgaagccgctcggcgtcgacaagcggccgttcaagaac
ccgaccgagaacgaccgccgcgcgcactgggtcaagccggtgctgctggccgaagtcact
ttttccgactggacgaaggacggccatgtgcggcacccggtgtttcacgccgtgcgctcg
gacaagcccgccaaggccatcgtccgcgagaagccggtgcaccaggcgggcgccgaccgc
gaacccgagcccgaaccagccgccaccatgcccgccaacttcaaggtctcgcatgccgac
cgcgtggtcgatccatcgacgggcatcacgaaggtggaggtggtgcgcttctacggcctg
gtcgcgccgctgatgatggcgcacctcaagggccggcccgtgtcgttcgtgcgcgcgccg
cagggcatcaacgggccgctcttcttccagaagcacctcgagctggggcagatggccggc
gtgcggcagctcgatgcggcactgtggccggaccaccccgagctgatcgaggtggcaggc
ccgctcggtctcctcagtgcggcgcagatgaacgtcatcgagttccacacctggaacggc
gtgaagacgctcatcggcaagcctgaccgcatgaccttcgacctcgacccgggagagggg
gtcggctggcccacggtgctgcaggcggcggagctgatgcgcgtggtgctcgacgaactg
ggcctggcgccgttctgcaagaccagcggcggcaaggggctgcacgtggtggtgccgctc
aagcggcagtacgactgggacaccatcaaggatttctcgcaggccatcgtgcggcacatg
gcgcgcaccctgccgcagatgttcgtcgccaagagcgggccgggcaaccgcgtcggccgc
atcttcatcgactacctgcgcaatggtttcggcgcgaccaccatctgcgcctggtcggtg
cgggcgcgtcccgggatgggtgtgtcggtgccggtggaatggcaggaggtgccaacgctc
acgagtggtgcgcagtggaccttgagaaacatccatgcccggctcgaccgcggcaacgat
ccgtgggccggctatgcgaaggcggccaagagtccgggcgctgcaatgaagatgctggga
ttcgaagcagccagtgcgcgcgcacgcaaacgctga

DBGET integrated database retrieval system