KEGG   Variovorax paradoxus B4: VAPA_1c22630Help
Entry
VAPA_1c22630      CDS       T02835                                 

Definition
(GenBank) putative aldehyde dehydrogenase
Organism
vpd  Variovorax paradoxus B4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2403011..2404432
Genome map
AA seq 473 aa AA seqDB search
MKCYTHFYADGQFLECTGADRMALISPSQGARIGDVVACSAHDVERAVRSARAGFRAWSA
SSIDERCGALQHLHRELESRAEAATQTLAEEMGCPAWLGRLMQLPMPLKGLAFAIEGLAQ
VQWRETIGNGIVERVPAGVVVAITPWNFPLHQIVAKVAAAIGAGCSVILKPSEVAPGAAQ
LFMEAVHACGLPAGVVNMVWGGASVGEQLTTHPQVDRISFTGSTDVGRKIMANAAQGLKP
VTLELGGKSAAVLLEDADLDAAIPAVVRLSMANSGQACVSQSRLIAPARLVPQIVERLRN
AIAGWPLGDPLEDATRLGPVATEGQLRRVRRMIGRAQEQGAQLLAGGAQPPAGLGQGWYV
QPTLFGDVRPEMEIAQEEVFGPVLALIPYQSEEEAADFANASRYGLSGAVWSRDAIRATE
FARRMRTGQVVINGAAQNLATPFGGWGLSGFGRENGRFGIEDLLNYRSLHGAA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtgctacacgcatttctacgccgacgggcagttcctcgaatgcacgggggcggac
cggatggcgctcatcagcccctcgcagggtgcgcgcatcggcgatgtggtcgcgtgttcc
gcgcacgacgtcgagcgtgccgtgcgcagcgcgcgcgccggatttcgcgcctggtcggcg
agcagcatcgacgagcggtgcggtgcgctgcagcacttgcatcgcgaactcgagtctcgc
gccgaagccgcgacgcagactttggccgaggagatgggctgtccggcctggctcggtcgc
ctgatgcagttgccgatgccgctgaaaggcctggcgtttgccatcgaagggctggcgcag
gtccagtggcgcgagaccatcggcaacggcatcgtcgaacgcgttccggcgggggtggtc
gtggcgatcacgccgtggaactttccgctgcaccagatcgtggcgaaggtggctgcggcg
atcggtgcgggttgcagtgtgatcctgaagcccagcgaagtcgcgccgggagcggcgcag
ttgttcatggaagcggtccatgcctgcggtctgcccgccggcgtggtgaacatggtgtgg
ggcggagcgtccgtcggcgagcaattgaccacccatccgcaggtggatcgcatcagtttc
accgggtcgaccgatgtcggccgaaagatcatggcgaacgcggcacagggattgaagccg
gtcaccctcgaactcggcggcaagtcggccgccgtgttgctcgaggacgccgacctcgac
gccgcgatacccgctgtcgtacgcctgagcatggcgaactccggacaggcctgcgtgagc
cagtcgcggctgatcgcgccggcccggctcgtaccgcagatcgtcgagcgcttgcgcaac
gcgatcgccggctggccgttgggcgatcccctggaagacgccacgcggctgggcccggtc
gcgaccgagggtcagctgcggcgggtgcgccgaatgatcggccgagcgcaagagcaagga
gcgcaactgctcgcaggtggagcacagccaccggccgggctcgggcagggctggtatgta
caacccacgctgtttggcgatgtccgtccggaaatggagatcgcgcaggaagaggtgttc
ggcccggtcctggcgctgattccctaccagagtgaagaggaggccgcggacttcgcgaac
gcgagtcgctacggtctctcgggcgcggtgtggtcgcgcgacgccatacgcgccaccgaa
tttgctcgccgcatgcgtaccggccaggtcgtgatcaatggggcggcccagaacctcgcc
acgccgttcggaggctgggggctttccggttttggccgcgagaacggccgcttcggcatc
gaagaccttctcaactatcgatcgctgcatggtgcggcctga

DBGET integrated database retrieval system