KEGG   Variovorax paradoxus B4: VAPA_1c38710Help
Entry
VAPA_1c38710      CDS       T02835                                 

Definition
(GenBank) putative non-ribosomal peptide synthetase
Organism
vpd  Variovorax paradoxus B4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(4101675..4106990)
Genome map
AA seq 1771 aa AA seqDB search
MEKNTQAQQAPISSRPKNFVAHLRALVDTRRDDIWLTVVSAVDGTDRAEAISYGVFERRV
RALATRLQQRFAKGERALVMLDNGDHYAVSMLACFYAGVIAVPVFPPESARPQHLARLTG
IAADSQARCVLTSEAMARAMNETSAGLRQFGDADIVAVDAVDIALADAWTPFEPAGGDVA
FLQYTSGSTSAPKGVVVMHGNLMANEEAIQRSMGVGPGDSFVSWAPLYHDMGLIGGLLQP
LYSGIPLVLTSPGYFLERPVRWLELISRHRATLSGGPDFAYRLCLERVKDAQLAQLDLSS
WRVAYTGAEPVRADTEVEFIARFASAGFDAAAVYPCYGLAEATLFVTGGRRGGGLVASAF
SAAGLASGTGTPADEGTTLVGCGDVAPGHRIEIVDAESLSAAAPGKIGEIWACGPSIGHG
YWGKERETRETFVERGGQRWLRTGDLGFMHEGQLYITGRIKDLIIVRGHNIYPQDIERLI
EAEVDAVRKGRVAVFAAEGPGGEGIGVAAEVSRSMQKLVPAAVLVDALGAAVSEVFGETL
SAVLLLNPGGMPKTTSGKLQRGACRAGWLDGSADAYAIYQHGAFVRGGPVEAVAEAPLDE
VEQAVAAIWREVCKHGDDRPLGRDAHFFNRGGSSLVATQAAARICARWQIDFPARRLFEQ
PRLRDCASAIRELQVQGVRPQPAPIAVLSAEHRLLPLPLSHAQERQWFLWQIDPESAAYH
VSGALRLAGALRVDALQAAFDDLVARHESLRTVFSAGVDGSVEQWIKPGSSVPLSLVDLR
GAEGEADAQLDEATRRLKAQPFDLTQGPLLRAALIRTVDEVHVLALVMHHIVSDGASMQL
LIDELAAGYAAHLKGDTVRVPAPRIQYADYALWQREWLAAGEGERQLAWWRTQLGDTHTV
LDLRTDHPRKPQAGYSAARHAFELPANLLAQLRRTTEAGGATLFMVLLAGFQALLHRYTG
QEDIRIGAPIANRNRVEAEGVVGLFVNTLVLRNPIHGRLGASRVLAQARDAVLGAQAHQD
VPFEQLVQMLQPERSLSHTPLFQVMFNHLFEDYRSLGRLPGIAAQDHVLPDLAAQFELAL
EAREQPGGQLSLAVIYAAELFEPDTIARMAGHYVAILQALAEHPHQPIGDIELLGAPEQA
RLAQWGVNTYREPQPEPVHRMIERQARTQPDATALLFADESLGFAELNRRANRVAHRLIA
LGVKPEVLVGIAMERSVEMVVAILGVLKAGGAYVPLDPEYPAERLAYMVQDSGIGLLLTQ
RSLVDCVPDRRALTVLEVDAADFGAEPESDPQVGLHIENLAYVIYTSGSTGKPKGAAIRH
SALHSCMAWMQGIYKLTRADTVLHKAPFGFDVSVWELFWPMTSGARLVVANPGDHRDPGR
LVELIQRHQVTTLNFVPSMLQVFLAHKGIETSTRLRHIICGGEAMPAETQKETLERLHGA
GLQNLYGPTETTIHVTHWACRNDGRSQVPIGRPISHTSTHVLDADLNLVPQGVAGELYLG
GVSLARGYLKRPGLSAERFVADPFDSVGGGRLYRTGDLVRWNGEGRLEYLGRIDHQVKIR
GFRIELGEIEAELLAQPAVREAVVVAREGPAGTRLVAYLAPHAGETIDTAVLKERLAQVL
PDYMVPRAFEVLDALPLNANGKVDRKALPEPALASGQAYEAPQGHVAQTVAAVWSEVLQV
AQVGLHDNFFDLGGHSLLLIRAHRLLEDQLHTAIPVVNLFKYPTVQSLVQWLEQAPARTA
ASAAAAAASDDRALRQRAAMLQRRKAAERVN
NT seq 5316 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaacacgcaggcgcagcaggcgccgatctcgtcgcgcccgaagaatttcgtg
gcgcaccttcgcgcgctggtggacacgcggcgcgacgacatctggctcaccgtcgtgagc
gcggtggatggcaccgaccgcgcagaggcaatcagctacggcgtcttcgagcgccgcgtg
cgcgccctcgcgacgcggctgcagcagcggttcgcgaagggcgagcgcgccctcgtcatg
ctggacaacggcgaccactatgccgtgagcatgctggcctgtttctacgcgggcgtgatc
gcggtgccggtgttcccgccggaatcggcgcgcccgcagcaccttgcacggttgaccggc
attgccgccgattcacaggcgcgctgcgtgctgacgtccgaggccatggcgcgcgcgatg
aatgaaacgagcgcgggcttgcgccagttcggcgatgcggacatcgttgccgtcgatgcc
gtggacatcgcgctcgccgacgcatggacgcctttcgagccggccggcggcgacgtcgcc
ttcctgcaatacacctcgggctccacctcggcgcccaagggcgtggtcgtgatgcacggc
aacctgatggccaatgaggaggcgatccagcgcagcatgggtgtcggcccgggcgacagc
ttcgtttcgtgggcgccgctctatcacgacatgggcttgatcggcggattgttgcagccg
ctctacagcggcattccgctggtgctcacctctccgggctatttcctggagcgcccggtg
cgctggctcgaactgatctcgcgccatcgcgcgacgctcagcggcggccccgacttcgcc
taccgcctgtgcctggagcgcgtgaaggatgcacaactggctcagctcgacctgtcgagc
tggcgcgtggcctacaccggtgccgaacccgtgcgcgccgacacagaagtcgagttcatc
gcgcgcttcgcctccgcgggcttcgacgcggcagccgtctatccctgctacggccttgcc
gaggcgaccctcttcgtcaccggcggccgccgaggcggcggcctggtcgcgtccgcgttt
tccgccgccggccttgccagcggcacgggaacacccgcagacgagggcacgacgctggtc
ggctgcggcgacgtcgcgcccggccatcgcatcgagatcgtcgatgccgaatcgctctcg
gccgcggcccccgggaagatcggcgagatctgggcctgcggtccgagcatcggccacggc
tactggggcaaggagcgcgagacgcgcgagaccttcgtcgagcggggcggccagcgctgg
ctgcgcaccggcgatctcggcttcatgcacgagggccagctctatatcaccggccgcatc
aaggacctgatcatcgtccgcggccacaacatctacccgcaggacatcgagcggctcatc
gaggccgaggtcgacgcggtgcgcaagggccgcgtcgcggtcttcgcggcagaggggccg
ggtggcgaaggcatcggcgtggccgccgaggtgtcgcgcagcatgcagaagctggtgccg
gcggcggtgctggtcgatgcgctgggcgccgccgtgagcgaagtgttcggcgagacgctg
tcggccgtgctgctgctcaaccccggcggcatgcccaagacaaccagcggcaagcttcag
cgcggtgcctgccgcgcgggctggctcgacggcagcgccgacgcctatgccatctaccag
cacggtgccttcgtgcgcggaggtccggtcgaggccgttgccgaagcgccgctcgacgaa
gtcgagcaggccgtcgccgccatctggcgcgaggtctgcaagcacggcgacgaccgcccg
ctcggccgcgatgcccacttcttcaaccgcggcggcagttccctcgtcgcaacccaggcg
gccgcgcgcatctgcgcgcgttggcagatcgacttccccgcgcgcaggctcttcgagcag
ccgcgccttcgcgactgcgcatcggccatccgcgaactgcaggtgcagggcgtgcgcccg
cagcccgcaccgatcgccgtgctctctgcggagcaccggctgttgccgttgccgctctcg
cacgcgcaggagcgccagtggtttctctggcagatcgatcccgagagcgcggcctaccat
gtgagtggcgcgctgcgcctggccggcgcgttgcgggtcgatgccctgcaggcggccttc
gacgatctcgtggcgcgccatgaatcgctgcgcacggtgttcagcgccggcgtcgacggc
agcgtggagcaatggatcaagccgggcagctcggtgccgctgtcgctggtcgacctgcgc
ggcgccgagggcgaagcggatgcgcaattggacgaagccacgcggcgcctcaaggcccag
cccttcgacctcacgcaggggccgctgctgcgcgccgcgttgatccgcaccgtcgacgag
gtgcatgtgctcgccctggtgatgcatcacatcgtgtccgacggcgcctcgatgcagttg
ctgatcgacgaactggccgcaggctacgccgcgcacctgaagggcgacaccgtgcgcgtg
cccgcaccgcgcatccagtacgccgactacgcgctctggcagcgcgagtggctggcggcg
ggcgagggcgagcggcagctggcctggtggcgcacgcagctcggcgacacgcacaccgtg
ctcgacctgcgcaccgaccacccgcgcaagccgcaagccggctacagcgccgcgcgccac
gccttcgaacttccggcgaacctgctcgcgcagttgcgccgcaccacggaggctggcggt
gccacgctcttcatggtgctgttggcgggcttccaggcgctgctgcaccgctacacgggc
caggaagacatccgcatcggcgcgccgattgccaaccgcaaccgcgtggaagccgaaggc
gtggtcggcttgttcgtcaacacgctggtgctgcgcaacccgatccatggccgcctcggc
gcatcgcgcgtgctggcgcaggcgcgggacgcggtgctgggcgcacaggcgcaccaggat
gtgcccttcgagcagctcgtgcagatgctgcagcccgagcgcagcctgagccacacaccg
ctgttccaggtgatgttcaaccacctgttcgaggactaccgctcgctcggccggttgccc
ggcatcgccgcgcaagaccacgtgctgcccgatctcgcggcgcagttcgagctcgcgctc
gaagcgcgcgagcagccgggcggccagctctcgctcgccgtgatctacgcggccgagctg
ttcgagcccgacaccattgcgcgcatggccggccactacgtcgcgatcctgcaggcgctg
gccgagcatcctcatcaacccatcggcgacatcgaactgctcggcgcgccggagcaggcg
cggctcgcgcaatggggcgtgaacacgtaccgcgagccgcagcccgagccggtgcaccgc
atgatcgagcggcaggcccgcacgcaacccgatgccactgcgctgctgttcgccgacgag
tcgctcggcttcgcggaactgaaccgccgcgccaaccgcgtggcgcaccggctgatcgcg
ctgggcgtgaagcccgaggtgctcgtgggcatcgcgatggagcgctccgtcgagatggtg
gtcgccatcctgggcgtgctgaaggcgggcggcgcctatgtgccgctggaccccgaatac
cccgccgagcgcctggcctacatggtgcaggacagcggcatcggcctgctgctcacgcag
cgcagcctggtcgattgcgtgcccgaccgccgcgcgctcacggtgctggaagtcgatgcc
gccgatttcggcgccgagcccgagagcgatccgcaggtcggcctgcacatcgagaacctc
gcctacgtgatctacacctcgggctccaccggcaagcccaagggtgcggccatccgccac
agcgcgctgcacagctgcatggcgtggatgcagggcatctacaagctcacgcgcgccgac
accgtgctgcacaaggcgccgttcggcttcgacgtgtcggtgtgggagctgttctggccg
atgacctcgggcgcgcggctggtggtggccaaccccggcgatcaccgcgacccggggcgc
ctggtcgagctgatccagcgccaccaggtcaccacgctcaatttcgtgccctcgatgctg
caggtctttctcgcgcacaagggcatcgagaccagcacgcgcctgcgccacatcatctgc
ggcggcgaggcaatgccggccgagacgcagaaggaaacgctcgagcgcctgcacggcgcg
ggcctgcagaacctctacggccccaccgagaccaccatccacgtcacgcactgggcctgc
cgcaacgacggccggagccaggtgcccatcggcaggccgatcagccacaccagcacccac
gtgctggatgccgacctcaacctcgtgccgcagggcgtggcgggtgagctgtacctgggc
ggcgtcagcctcgcgcgcggctacctgaagcggcccggcctgagcgccgagcgcttcgtg
gccgacccgttcgacagcgtcggcggcgggcggctctaccgcaccggcgacctcgtgcgc
tggaacggcgaaggacggctggagtatctgggccgcatcgaccaccaggtgaagatccgg
ggctttcgcatcgagctcggcgagatcgaggcggaactgcttgcgcagcccgccgtgcgc
gaagctgtcgtggtggccagggaaggcccggccggcacgcggctcgtcgcctacctcgcg
ccgcatgcgggcgagaccatcgacaccgcggtgttgaaggagcggcttgcgcaggtgctg
cccgactacatggtcccgcgcgccttcgaggtgctcgatgcgctgccgctgaacgccaac
ggcaaggtggaccgcaaggcactgcccgagccggccctcgccagcggccaggcctacgag
gcgccgcaaggccatgtcgcgcagacggtggccgcggtgtggtccgaggtgctgcaggtc
gcgcaggtcggcctgcacgacaacttcttcgacctgggcggccactcgctgctgctgatc
cgcgcgcaccggctgctggaagaccagctgcacaccgccatccccgtggtcaatctcttc
aagtaccccaccgtccaatcgctggttcagtggctggagcaggcgcccgcgcgtaccgcc
gcatcggccgctgcggccgcggcgagcgacgaccgtgcgctgcgccagcgcgccgccatg
cttcaacgccgcaaagcggcagagagagtcaactga

DBGET integrated database retrieval system