KEGG   Variovorax paradoxus EPS: Varpa_1915Help
Entry
Varpa_1915        CDS       T01392                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Varpa_1915
Enzymes [BR:vpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Varpa_1915
Transporters [BR:vpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   Varpa_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2110509..2111174)
Genome map
AA seq 221 aa AA seqDB search
MTTHIYSGPLSMFGAKVEIAAREKGVAFDLVMVPFTKDDAYEPKHPEVLRVNAVKQQVPV
LVDDAVALFDSTQIFEYLEDRYPTPALWPEGIADRARARQLEQKADEVFFPNVIKLFGLQ
NDMQSAPAVAACAACARYYAEMEGLLAGREYLAGPYSFADIAFYMACIFADRKGAGMTDA
TPRLIAWRNRVRDRPAVHAVVDPMMKFLASEGREVPAFLQR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcacatctattccggccccctcagcatgttcggcgccaaggtcgagatcgcg
gcacgcgaaaaaggcgtcgccttcgacctcgtcatggtgccgttcaccaaggacgacgcc
tacgagccgaagcaccccgaggtgcttcgggtcaacgccgtcaagcagcaggtgcccgtg
ctggtcgacgacgcggtggcgctgttcgactcgacccagatcttcgaatacctcgaagac
cgctaccccactcccgccctgtggcccgaaggcatcgccgaccgggcacgggcgcggcag
ctggagcagaaggccgacgaggtgttcttcccgaacgtcatcaagctcttcggcctgcag
aacgacatgcagagcgcgccggccgtcgccgcgtgcgcagcctgcgcgcgctactacgcc
gagatggaaggcctgctcgccggacgcgaatacctcgcgggcccctactccttcgcggac
atcgccttctacatggcctgcatctttgccgaccgcaagggcgccggcatgaccgatgcg
acgccacgcctcatcgcctggcgcaaccgcgtgcgcgaccgacccgcggtgcatgcggtg
gtcgatccgatgatgaagttcctcgcctccgagggccgcgaggtgcccgccttcctgcag
cgctga

DBGET integrated database retrieval system