KEGG   Variovorax paradoxus EPS: Varpa_4327Help
Entry
Varpa_4327        CDS       T01392                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
vpe  Variovorax paradoxus EPS
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4688113..4693413)
Genome map
AA seq 1766 aa AA seqDB search
MNELLATASAGRQPRNFVAHLRALAEGRPHDVWLTVVDEVDGAYSELPFTYAVFEQRVRA
LAARLQQQFAKGDRALVMLDNGDHYAVSMLACFYCGVIAVPVFPPESTRPQHLARLTGVA
ADSSARCVLTSSALSAAMSAADNQFGDVQIVAVDAIDIALADAWQPFEPSDDDVAFLQYT
SGSTSAPKGVIVTHGNLMANEHAIQVGMGIGPDDKFVSWAPLYHDMGLIGGLMQPLYSGI
PLVLTSPRYFLERPVRWLELISRHRATLSGGPDFSFRLCLERVKDAQFAQLDLSSWRVAY
TGAEPVRADTEFDFIERFAPAGFDPGAVYACYGLAEATLFVTGGKRGSGMVARGFGADGL
ASGKGTPSEDGTLLVGCGAVAVEHVVEIVDPATLSVVAEPGRIGEIWVSGASVGAGYWGK
PRESAETFVERAGRRWLRTGDLGFVCDSELYVTGRIKDLIIVRGHNIYPQDIERVIEAEV
DAVRKGRVAVFAANGPDGEGIGAAAEVSRSMQKLVPPQVLVEALSAAVSEVFGEALSAVL
LLNPGGMPKTTSGKLQRNACRAGWLDRSADAYAIYERGAFVKGGSVEAQAEAPVLDETEH
AVDAIWREVLRPADAKPFARDSHFFTRGGSSLTATQVAARVSDHWDIDFPVRLMFEHPRL
SECAAAVRQRLAEGARARPAPIAVLPAERRLRALPLSHAQERQWFLWQLDPTSAAYHMSG
ALRLTGALQADVLRAALDDLVVRHESLRTVFRAGSDGVAAQWVQSTGTLPLEVVDLRDVA
ADERDARLESEARRIKSAPFDLTQGGLLRAALLRLADDTQVLAVVMHHIVSDGASMQVLI
DELAAGYAARLQGRAAALPLPRVQYADYAVWQREWLAAGEAERQLAWWQKELGDEHPVLE
LRTDRPRKPQASYRAARHTFELPTPLLSQLRGVAQADGGTLFMVLLAGLQVLLHRYTGQE
EIRVGAAIANRNRVEFENVIGLFVNTLVLRNPIDGRTSLSRALAQAREAVLGAQAHQDLP
FEQLVQRLQPERSMSHSPLFQVMFNHLFEDHRALQRLDGIQVQDHALPDLQTQFDWVLEA
RERPDGRLMLDVIYADDLFERETIARMAQHYVAVLGVLCADTGRAVGDIVLLDAAENAQL
AGWSINARREPQPQPVHQTIAQHAKQQPDAVALLFGEEALSFAELDRRANHLAHRLVALG
VKPDMRVGIVMERSVEMVVGLLAILKAGGAYLPLDPDYPLQRLAYMVEDSGIALLLTHRA
TREHIAECAGLARLEVDSTDLSNEPDTDPGVALHGENLAYVIYTSGSTGKPKGAAVRHAA
LHSCIAWMQDTYRLGRDNTVLHKAPFGFDVSVWEMFWPLTAGARLVVANPGDHRDPARLV
ELIQRHQITTLNFVPSMLQAFLAHKDIESSTRLKHIICGGEAMPAETQKETLQRLHGATL
QNLYGPTETTIHVTHWTCRDDGQSLVPIGQPISDTQCHILDAELNQVPRGVAGELYLGGV
SLARGYLNKPGLSAERFVANPFGAGDRLYRTGDLVRWNTEGQIEYLGRIDHQVKIRGFRI
ELGEIEAQILAQPAVREAVVVAREGAAGASLVAYIAAHAQQAVDTAALREQLGQVLPDYM
VPRAVVVLEALPLNANGKVDRKALPEPEGLGRASTYEAPQGHVARTLAAIWSEVLQVEQV
GLHDNFFDLGGHSLLLIRAHRLLEDRLQGSFPLVNLFKYPTVESLARWIEQGGAQAAAVS
AASADDRALRQRAAMLQRRKVAERVN
NT seq 5301 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactgctcgcgacggcatccgccggccggcaaccgcgcaatttcgtggcgcac
ctgcgcgcgttggccgaggggcgtccgcacgatgtctggctcaccgtggtcgacgaggtc
gatggtgcctacagcgagctgcctttcacctatgccgtcttcgagcagcgcgtgcgcgcg
ctcgcggcccgcctgcagcagcagttcgccaagggcgaccgcgcgctcgtcatgctcgac
aacggcgaccactatgcggtgagcatgctggcctgcttctactgcggtgtgatcgcggtg
ccggtgtttccgcccgaatcgacgcgaccgcagcacctggcgcggctcaccggcgtggcg
gctgattcatcggcgcgttgcgtgctcacgtcttctgccttgagcgccgcgatgtcggcg
gccgacaaccagttcggcgatgtgcagatcgttgccgtcgatgcgatcgacatcgcgctc
gccgacgcctggcagcccttcgagccaagcgacgacgacgtcgccttcctgcaatacacc
tcgggttcgacctcggcgcccaagggtgtcatcgtcacgcacggcaacctgatggccaac
gagcatgcgatccaggtcggtatgggcatcgggcccgacgacaagttcgtttcgtgggcg
ccgctctatcacgacatgggcctgatcggcggcctgatgcagccgctgtacagcggcatc
ccgctggtgctgacttcgccgcgctatttcctcgagcgtccggtgcgctggctggagctg
atctcgcgccaccgcgccacgctcagcggcggtccggacttctcgttccgcctctgctta
gagcgggtgaaggatgcgcagttcgcgcagctcgacctctcgagctggcgcgtggcctat
accggcgccgagccggtgcgcgccgacaccgaattcgatttcatcgaacgcttcgccccc
gcgggcttcgatcccggtgcggtctatgcctgctacggcctcgccgaagcgaccctgttc
gtgaccggcggaaagcgcggctccggcatggtcgcgcgcggcttcggcgccgacggcctg
gcatccggcaagggcacgccgagcgaagacggcacgctgctcgtcggatgcggcgcggta
gcggtcgagcatgtagtcgagatcgtcgatcccgccacgctgtcggtggtggccgagccc
ggacgcatcggcgaaatctgggtgagcggcgcgagcgtcggggcgggctactggggcaag
ccgcgcgaatccgccgagaccttcgtcgagcgtgcgggccgccgttggctgcgcaccggc
gacctgggcttcgtctgcgatagcgagctctacgtgaccggccgcatcaaggacctgatc
atcgtccgcggccacaacatctatccgcaggacatcgagcgcgtcatcgaggccgaggtc
gatgcggtgcgcaagggccgcgtggcggtcttcgcggccaacggccccgacggcgagggc
atcggcgccgcggccgaggtgtcgcgcagcatgcagaagctggtgccgccgcaggtgctg
gtcgaggcgctgagcgccgcggtgagcgaggtgttcggcgaagcgctgtcggccgtgctg
ctgctcaacccgggcggcatgcccaagaccaccagcggcaagttgcagcgcaacgcgtgc
cgcgcgggctggctcgatcgcagcgcggatgcgtatgcgatctatgagcgtggcgcattc
gtcaagggcggttctgtggaagcgcaggccgaagcgccggtgctggacgagaccgagcat
gccgtcgatgcgatctggcgcgaagtgctccggcccgccgacgcgaagcctttcgcgcgc
gactcccatttcttcacccgcggtggcagttcgctcaccgccacccaggtcgcggcccgc
gtgtcggatcactgggacatcgactttccggtgcgcctgatgttcgaacacccgcggctc
tccgagtgcgccgccgccgtgcgccagcgcctggccgaaggcgcgcgtgcgcggcccgcg
cccatcgcggtgctgccggccgagcgccggctgcgcgcgttgccgctgtcccatgcgcag
gagcgccagtggttcctctggcagctcgacccgacgagcgcggcgtaccacatgagcggc
gcgctgcgcctcaccggtgccttgcaagccgatgtgctgcgcgcggcgctggacgatctc
gtcgtgcgccacgagtcgctgcgcaccgtgttccgcgcgggcagcgacggcgttgccgcg
cagtgggtccagtcgaccggcacgctgccgctcgaagtggtcgacctgcgcgacgtggcc
gccgatgaacgtgacgcgcgcctggagagcgaggcccgccgcatcaagagcgcgcccttc
gatctcacccagggcggcctgttgcgcgccgcgctgctgcgcctcgcggacgacacgcag
gtgctcgccgtggtgatgcaccacatcgtgtccgacggcgcctcgatgcaggtgctgatc
gacgagctggccgccggatacgcggcgcgcctgcagggccgtgccgcggcgctgcccttg
ccgcgcgtgcagtacgccgactacgcggtttggcagcgcgaatggctggccgccggcgag
gccgaacgtcagctcgcctggtggcagaaggagctcggcgacgagcacccggtgctcgaa
ctgcgcaccgaccgcccgcgcaagccacaagccagctaccgcgccgcacgccacaccttc
gaattgccgacgcccttgctcagccagttgcgcggcgttgcacaggccgacggcggcacg
ctgttcatggtgctgctcgccggcctgcaggtgctgctgcaccgctacaccgggcaggaa
gaaatccgcgtcggcgccgcgatcgccaaccgcaaccgggtcgagttcgagaacgtcatc
ggcttgttcgtcaacacgctggtactgcgcaacccgatcgacggccgcacgtcgttgtcg
cgtgcgctcgcgcaagcccgcgaggccgtgctgggcgcgcaggcgcaccaggacctgccc
ttcgagcaactggtgcagcgtctgcagcccgagcgcagcatgagccacagcccgctgttc
caggtgatgttcaaccacctgttcgaggatcaccgcgcactgcagcggctggacggcatc
caggtgcaggaccacgcgttgcccgacctgcagacccagttcgactgggtactggaagcc
cgcgagcggcccgacggccggctgatgctcgacgtgatctatgccgacgacctgttcgag
cgcgagaccatagcgcgcatggcgcagcactacgtggcggtactcggcgtgctctgtgcc
gacaccggccgcgcggtgggcgacatcgtcttgctcgatgccgcggagaacgcgcaactc
gcaggctggagcatcaacgcgcgccgcgagccgcaaccccaaccggtgcaccagaccatc
gcgcagcatgcgaagcagcagcccgatgccgtcgcgctgctgttcggcgaagaagcgctg
agcttcgccgagctcgaccgccgcgccaaccatctcgcgcaccgcctggtcgcgctcggc
gtgaagcccgacatgcgcgtgggcatcgtgatggagcgctcggtcgagatggtggtgggg
ctgctcgccatcctcaaggccggcggcgcctacctgccgctggaccccgactacccgctg
cagcgcctggcctacatggtggaggacagcggcatcgcgctgctgctgacgcaccgcgcc
acccgcgagcacatcgccgagtgcgcgggccttgcgcggctggaagtcgacagcaccgat
ctctcgaacgagcccgacaccgaccccggcgtcgcgctgcacggcgagaacctcgcctat
gtcatctacacctccggctccaccggcaagcccaagggcgcggccgtgcgtcacgccgcg
ctgcacagctgcattgcctggatgcaggacacctaccgcctgggtcgggacaacaccgtg
ctgcacaaggcgccgttcggcttcgacgtgtcggtgtgggagatgttctggcccctgacc
gcgggcgcgcggctggtggtggccaaccccggcgaccaccgcgacccggcacgtctggtc
gagctgattcagcgccaccagatcacgacgctcaacttcgtgccctcgatgctgcaggcc
ttcctggcgcacaaggacatcgaatcgagcacgcggctcaagcacatcatctgcggcggc
gaggccatgcccgccgagacgcagaaggagacgctgcagcgccttcacggcgccacgctg
cagaacctctacggcccgacggaaacgacgattcacgtcacgcactggacctgccgcgac
gatggccagagcctggtgccgatcggccagccgatcagcgacacccagtgccacatcctc
gatgccgagctcaaccaggtgccgcgcggcgtggccggcgagctgtacctcggcggcgtg
agcctggcgcgcggctacctcaacaagcccggcctcagtgccgaacgcttcgtggccaat
cccttcggcgcaggcgaccggctctatcgcaccggtgacctcgtgcgctggaacaccgag
ggccagatcgagtacctgggccgcatcgaccatcaggtgaagatccgcggcttccgcatc
gaactcggcgagatcgaggcgcagatcctcgcgcagcccgccgtgcgcgaggccgtggtg
gtggcgcgcgaaggcgcggcgggcgcctcgctcgtggcctacatcgccgcgcatgcgcag
caagcggtcgacaccgccgcgttgcgcgagcaactgggccaggtgctgcccgactacatg
gtgccgcgcgccgtggtggtgctcgaagccctgccgctgaacgccaacggcaaggtcgac
cgcaaggcgctgcccgagcctgaaggccttggccgcgcgagcacttacgaggcaccgcag
ggccatgtggcgcgcacgctcgcggccatctggtcggaggtgctgcaggtcgagcaggtc
ggcctgcacgacaacttcttcgacctcggcgggcactcgctactgctcatccgcgcgcac
cgcctgctggaagaccggctgcagggcagcttcccgctggtcaatctcttcaagtacccc
accgtcgaatcgctcgcgcgctggatcgagcagggcggcgcgcaagccgcggccgtttcc
gcggcaagcgccgacgaccgcgcgctgcgccagcgcgcggccatgcttcaacgccgcaaa
gtggcagagagagtcaattga

DBGET integrated database retrieval system