KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_21343Help
Entry
VPUCM_21343       CDS       T03116                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Brite
Enzymes [BR:vph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VPUCM_21343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:1459837..1460352
Genome map
AA seq 171 aa AA seqDB search
MLKGLLCISAAAAFVMTPNALAQSITMTDLGTNQAVGTVELSESDYGIVFTPNLSGIPAG
LHGFHVHANPSCDSAEKDGKTVVGGGAGGHYDPDNTGQHGFPWTDGNHLGDLPALYADME
GNANQPVLAPRLKMSDLKGRALMIHAGGDNHSDQPAKLGGGGARIVCGVID
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggattgctgtgcatctcagcggcggctgctttcgtgatgacaccaaacgcg
ttggcccaatcaatcaccatgaccgatttgggtactaaccaagccgtcggtacggtggaa
ttatcagagagtgactacggaattgtattcacgccgaatctgtcaggaattcctgccgga
ctacatggctttcacgtccacgctaacccatcctgtgacagtgcagaaaaggacggtaaa
accgtagtaggtggcggtgcgggcggccattacgacccagacaatactggccaacatggt
tttccatggaccgatggtaaccatcttggcgatctgccagcgttgtacgccgacatggaa
ggaaacgccaaccaaccggttttagctccgcgcctcaaaatgtcggatttaaaaggcaga
gccttgatgattcatgctggtggggacaatcactcggatcaaccagccaaattaggtggc
ggcggtgcgcgcattgtgtgtggcgtgatcgactaa

DBGET integrated database retrieval system