KEGG   Vagococcus penaei: BW732_09575Help
Entry
BW732_09575       CDS       T04715                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
vpi  Vagococcus penaei
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BW732_09575
Enzymes [BR:vpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BW732_09575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2010481..2011071
Genome map
AA seq 196 aa AA seqDB search
MAQLFFKFGAMNSGKTIEILKVAHNYEEQNKPVVLMTSGIDTRDEVGTISSRIGLRREAI
PIFSETNVFQAIKALPFTPYCVLVDESQFLEKHHVIEFAKIVDELNIPVMAFGLKNDFKN
ELFEGSKYLLLYADKLEELKTICWFCHKKATMNLRMSNNRPVYDGEQIQIGGNESYYPVC
RKHYVNPPCCDDEVKS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttattttttaaatttggcgcaatgaatagtggaaaaactattgaaatttta
aaagttgctcataattatgaggagcaaaataaaccagttgttttaatgactagtggtatt
gatactagggatgaagtgggaacgatatctagtcgaattggattaaggcgagaagctatc
ccgattttcagtgaaacaaacgtctttcaagcaatcaaagccttaccctttacaccgtat
tgtgtattagtggatgaatcacaatttttagaaaaacatcatgttattgaatttgcaaaa
attgtcgatgaattgaatattccagtaatggcttttgggttgaaaaatgattttaaaaat
gaattgtttgaaggttcaaagtatctgctgctttatgcagataaattagaagaattgaaa
acgatttgttggttctgccacaaaaaagcaacaatgaatttgcgtatgagtaacaatcga
ccggtctatgatggtgaacaaattcaaattggcgggaatgagtcgtactatcctgtttgc
cgaaaacactatgttaatccaccttgttgtgatgatgaggtcaagtcataa

DBGET integrated database retrieval system