KEGG   Vibrio qinghaiensis: CCZ37_07465Help
Entry
CCZ37_07465       CDS       T05259                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00240  Pyrimidine metabolism
vqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vqi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CCZ37_07465
Enzymes [BR:vqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CCZ37_07465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 DUF4528 AAA_30
Motif
Other DBs
NCBI-ProteinID: ASU22438
UniProt: A0A223MXY7
LinkDB All DBs
Position
1:complement(1630486..1631064)
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIYTAAIDDRYGVGKVSSRIGLESDAQ
LFTAETNLYDEINALHEQQKRHCILIDECQFLTKEQVYQLTEVVDKIGIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIAEGDQVSIGGNDKYVS
VCRQHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaaatgtatttctattactctgcgatgaatgcaggtaaatcaaccactctttta
caatcttctttcaactaccaagagcgtggtatgacacccgtgatctataccgccgccatc
gacgaccgctatggtgttggtaaagtcagctcaagaataggattggaatcggacgctcag
ctttttactgctgaaacgaatttgtatgatgagatcaacgcactgcacgagcaacaaaag
cgtcactgcattttgattgatgagtgccaattcttaaccaaagagcaagtctatcaattg
actgaagtggtcgataaaatcggcattccggtactgtgctatggcttgcgtaccgatttt
ttaggtgagctatttgaagggagtaaatacctactttcttgggccgataagctggtggaa
ttgaaaacaatttgtcattgtggccgcaaagcgaatatggtcattcgcaccgatgagcat
ggtgtggcgattgccgaaggtgatcaagtatctattggtggtaacgataaatacgtgtcg
gtatgtcgtcagcactataaagaagccttgggtaagtaa

DBGET integrated database retrieval system