KEGG   Vibrio qinghaiensis: CCZ37_17200Help
Entry
CCZ37_17200       CDS       T05259                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vqi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CCZ37_17200
Enzymes [BR:vqi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCZ37_17200
Transporters [BR:vqi02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCZ37_17200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ASU24205
UniProt: A0A223N2Z7
LinkDB All DBs
Position
2:complement(772674..773282)
Genome map
AA seq 202 aa AA seqDB search
MKVYGDIQSGNCYKVKLLLAFLGIEHEWHHVNILKGDTKTAEFLSINPNGKIPAVVLDDG
RCLSESNAILGYFADGTALIPSDQYEKAKMYEWLFFEQYSHEPFIAVARFIQKYQGMPES
RLEEYRALQPGGNKALSIMESRLAQTDYLAGKQLTIADIALYAYTHVADEGGFNLSDYPN
IQAWCKRLQEQAGYVGMTETNT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtttatggagatatccaatctggaaactgttacaaggtcaagctgttgcttgcc
ttcttaggcattgaacatgaatggcatcacgtcaatattttaaaaggtgacacaaaaaca
gccgagtttttatccattaacccaaacggaaaaatacccgcagttgttttggatgatggt
cgttgtttatcagagtcgaacgcaattcttggctattttgcagatggcacagcgttaatt
cctagtgaccaatatgaaaaggctaaaatgtacgaatggttgttctttgaacaatacagt
catgagccatttatcgccgtggctcgttttatccaaaaatatcaaggtatgccagagtca
aggttagaggaatatcgtgccttacaacctggaggtaataaagccttatcaataatggaa
agtcgcttagctcaaacggattatcttgctggtaagcaactcactatcgctgatattgca
ctgtacgcttatacgcatgttgcagatgaaggtggttttaacttatccgattaccccaat
attcaagcgtggtgcaaaagactccaagagcaagcaggctacgttggtatgacggaaaca
aacacataa

DBGET integrated database retrieval system