KEGG   Vigna radiata (mung bean): 106755003Help
Entry
106755003         CDS       T04126                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00010  Glycolysis / Gluconeogenesis
vra00051  Fructose and mannose metabolism
vra00052  Galactose metabolism
vra00500  Starch and sucrose metabolism
vra00520  Amino sugar and nucleotide sugar metabolism
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
vra01200  Carbon metabolism
Module
vra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106755003
   00051 Fructose and mannose metabolism
    106755003
   00052 Galactose metabolism
    106755003
   00500 Starch and sucrose metabolism
    106755003
   00520 Amino sugar and nucleotide sugar metabolism
    106755003
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106755003
Enzymes [BR:vra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106755003
Membrane trafficking [BR:vra04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106755003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106755003
NCBI-ProteinID: XP_014492582
UniProt: A0A1S3TFR7
LinkDB All DBs
Position
2
AA seq 499 aa AA seqDB search
MGRVVVGVTVGLATVACAVAAVVVGGRMRSRGKWKRVVRVLREVEEGCESSVERLRQVVD
AMAVEMHAGLASEGGSKLKMLLTYVHNLPDGTEKGTYYALDLGGTNFRVLRVHLHDQLSS
VLEHEVERQAIPQHLLTSTSKDLFDFIASSLKEFIEKEGDGSELSMDRRRELGFTFSFPV
KQTSVSSGILIKWTKGFSIVDMVGVDVPACLQEALIRTGLDVRVAALVNDTVGTLALGHY
HDSDTVASVIIGTGTNACYLERVDAIIKCQGHLTSSGYMVVNMEWGNFWSSHLPRTSYDI
DLDSESPNPNDQGFEKMISGMYLGDIVRRVILRMSLESDMFGHVSSKLNMPFTLRTPMMA
AMHEDDSPDLREVARILRDILEIPDVPLKLRKVVVKVCDVVTRRAARLAAAGIVGILKKI
GRDGSGGITSGRRSDVKMKRTVVAIEGGLYSSYTLFREYLHEALNEILGEDIAKHVILKV
TEDGSGVGAALLAASHSFL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggggagagtggtggtgggagtaacggtgggtttggcgacggttgcgtgtgcggtggcg
gcggtggtggttggagggagaatgaggagcagggggaagtggaagagagtggtgagagtg
ttgagggaggttgaggaagggtgtgaaagttctgttgagaggctgaggcaagtggtggat
gctatggcggttgagatgcacgcagggttggcttcagaaggtggttcaaagctcaaaatg
cttctcacctatgttcataatctccctgatgggactgagaaagggacatattatgcacta
gatcttgggggtacaaattttagggttttgcgggttcatttacacgatcagctatcctct
gttttggaacatgaagtagagcgacaagccatccctcaacatctactgaccagcacaagc
aaggatctctttgatttcattgcttcatctttaaaggaattcatcgagaaagaaggagac
ggttctgagctttcaatggacagaagaagggaacttggattcacattttctttccctgtg
aaacaaacgtcagtttcttcaggcattttaattaaatggacaaaaggtttttccattgta
gatatggtaggagtagatgttcctgcttgtttgcaggaagcattgatacgaacgggacta
gacgtgcgggttgctgccttggtcaatgatactgtgggaacactggctcttggacattat
catgactcagatacagttgcttccgtaataattggcaccggtaccaatgcttgctatttg
gaacgggttgatgctattataaagtgtcaaggtcatcttacatcatcaggatacatggtt
gtaaatatggaatggggaaatttttggtcatctcatttaccaagaacatcatatgatatt
gatttagactccgaaagccctaatccaaatgatcagggttttgagaaaatgatatcagga
atgtatcttggtgacattgtgaggagagtcattttaaggatgtcgctggagtcagatatg
tttggacatgtttcttccaagcttaatatgccctttacgctgaggactcctatgatggct
gctatgcacgaggatgattctcccgacttgagagaagtagcaagaatcctcagagacatc
cttgagattcctgatgttcctctgaagttaagaaaagttgtggtgaaggtttgtgatgtg
gtgactcgcagagctgcacgattggcagctgctggtattgttggtatcttgaagaagatt
ggtagagatggaagtggtggcatcacaagtggacgtagaagtgatgtgaaaatgaaaaga
acagttgttgcaattgaaggaggcttatattctagctatacattgtttagggagtatttg
catgaagctttgaacgaaatattgggggaagatattgccaagcatgtaattcttaaggtc
actgaagatggatcaggcgttggagcagcgctgcttgctgcctcgcattcattcctatga

DBGET integrated database retrieval system