KEGG   Vigna radiata (mung bean): 106776061Help
Entry
106776061         CDS       T04126                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00250  Alanine, aspartate and glutamate metabolism
vra00410  beta-Alanine metabolism
vra00430  Taurine and hypotaurine metabolism
vra00650  Butanoate metabolism
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    106776061
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106776061
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106776061
   00430 Taurine and hypotaurine metabolism
    106776061
Enzymes [BR:vra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     106776061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 106776061
NCBI-ProteinID: XP_014518850
UniProt: A0A1S3VKP6
LinkDB All DBs
Position
10
AA seq 501 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFRMPEESIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEESETAVG
VGTVGSSEAIMLAGLAFKRRWQNRRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPDQAVELVDENTICVAAILGSTLNGEFEDVKRLNDLLIEKNKQTGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRDNMLVLKEGLEK
TGRFAIVSKDNGVPLVAFTLKDHTHFDEFQISDLLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVADVEKVLHELDGLPARVISSTTVAVNTEENGKVVKKSALETQREIT
AVWKKFVLERKKLNDKMNGVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaaaccgcttcggaatccgacgtttctgtccactccaccttcgcttct
cgttatgtgagaacttcacttcccaggttcaggatgccggaggagtcgattccaaaggaa
gcagcgtaccagatcataaacgatgagttgatgttggatgggaacccaaggttgaacttg
gcttcgtttgtgacgacatggatggaacctgagtgtgataaactcatcatggcttccatc
aataagaactatgttgacatggatgagtaccctgtcaccactgagcttcagaaccgatgt
gtgaacatgatagctcatctttttaatgcaccacttgaagaatctgaaactgctgttggt
gttggcacggtcggttcatcagaggccataatgttggctggattggccttcaaaaggagg
tggcaaaacagaaggaaagcagagggaaagccttatgacaaacccaacattgtcactgga
gccaacgttcaggtttgctgggagaaattcgcaaggtacttcgaggtggagttgaaggaa
gtgaagctgcgtgatggatactatgtaatggatcctgaccaggctgtggaattggtggat
gagaacactatttgtgttgctgctatccttggttccacactaaacggagagtttgaggat
gtcaaacgcctcaatgatcttcttattgaaaagaataagcaaactgggtgggacactcct
attcatgttgatgcagccagtggtggattcattgctccatttatctacccagagcttgag
tgggatttccgattacctctagtgaagagcatcaatgttagtggacacaagtatggtttg
gtgtatgctggaatcggttgggttatctggaggagcaaggaggacctgcctgaagaactc
atcttccatatcaactatctcggagctgatcaacccaccttcacacttaacttctccaaa
ggttccagccaagtcattgctcaatactaccaactaattcgccttggttttgagggctac
agaaacgtgatggaaaattgcagagacaacatgttggtgctgaaagagggactcgagaag
acagggcggtttgccattgtgtccaaagacaatggtgtgcctttggttgctttcaccctg
aaagaccacactcactttgacgagtttcaaatctctgacctgctgagacgttttggatgg
attgtgccagcatacaccatgcccccagatgctcaacatgttacagtgcttcgtgttgtc
atcagggaggacttttcaagaactcttgcagagcgtctggtggcagatgtggaaaaggtg
ttgcatgagcttgatggccttccagcaagggtgatcagtagcaccactgtggcagtcaac
acagaagaaaatggcaaagtggttaagaagagtgctctagagacacagagggaaatcact
gcggtttggaagaagtttgtgttggagaggaagaagctcaatgacaagatgaatggtgtt
tgctag

DBGET integrated database retrieval system